FC875271

Overview
NameFC875271
Unique NameFC875271
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10194 contig Ccv1_Contig10194:1..665. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26L_HUMAN (Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens GN=RPS26P11 PE=5 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.079e-20
Identity = 43/64 (67.19%), Postives = 52/64 (81.25%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C P DKAIK+F++RNIVE AAVRD+ E  V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCVRCVPTDKAIKKFVIRNIVEAAAVRDISEVSVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26A_SCHPO (40S ribosomal protein S26-A OS=Schizosaccharomyces pombe GN=rps26a PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.607e-19
Identity = 40/63 (63.49%), Postives = 51/63 (80.95%), Query Frame = 1
Query:  115 KFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            KF+RC NC +  PKDKAIKR+ +RN+VE AA+RD+ EA VY  Y +PK+Y K+QYCVSCAIH+
Sbjct:   19 KFVRCINCSRAVPKDKAIKRWNIRNMVETAAIRDLSEASVYSEYAIPKIYVKLQYCVSCAIHA 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26B_YEAST (40S ribosomal protein S26-B OS=Saccharomyces cerevisiae GN=RPS26B PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.207e-18
Identity = 43/64 (67.19%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            VK +RC NC K  PKDKAIKR  +RNIVE AAVRD+ EA VY  Y LPK Y K+ YCVSCAIH+
Sbjct:   18 VKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALPKTYNKLHYCVSCAIHA 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26A_YEAST (40S ribosomal protein S26-A OS=Saccharomyces cerevisiae GN=RPS26A PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.207e-18
Identity = 43/64 (67.19%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            VK +RC NC K  PKDKAIKR  +RNIVE AAVRD+ EA VY  Y LPK Y K+ YCVSCAIH+
Sbjct:   18 VKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALPKTYNKLHYCVSCAIHA 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_DICDI (40S ribosomal protein S26 OS=Dictyostelium discoideum GN=rps26 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.764e-18
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYD--GYTLPKLYAKMQYCVSCAIHSH 306
            V +IRC+NC +C PKDKA+KRF +R IVE AAV+D+ +  V++  GY  P+ Y K QYC+SCAIHSH
Sbjct:   18 VPYIRCTNCARCVPKDKAVKRFYIRPIVENAAVKDISDQGVFNVKGYKFPRTYVKSQYCISCAIHSH 84          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_OXYNO (40S ribosomal protein S26 OS=Oxytricha nova GN=RPS26 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.297e-14
Identity = 34/63 (53.97%), Postives = 47/63 (74.60%), Query Frame = 1
Query:  121 IRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVY--DGYTLPKLYAKMQYCVSCAIHS 303
            +RC+NCG+   KDKAIKRF  RN+V+ ++ RD+QE   Y    +T+PK+Y K+ YCVSCAIH+
Sbjct:   21 VRCTNCGRVVSKDKAIKRFQQRNMVDASSKRDIQENYAYAQSDFTMPKIYVKLSYCVSCAIHA 83          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_ENCCU (40S ribosomal protein S26 OS=Encephalitozoon cuniculi GN=RPS26 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.061e-12
Identity = 29/61 (47.54%), Postives = 46/61 (75.41%), Query Frame = 1
Query:  121 IRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            I+C  CG   PKDKAIKRF +++++EQA+  D+++A +YD + +P++  K Q+CVSCA H+
Sbjct:   18 IQCDKCGSVTPKDKAIKRFRIQSLIEQASFDDLKQATIYDVFEVPRMGYKSQFCVSCACHA 78          
The following BLAST results are available for this feature:
BLAST of FC875271 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RS26L_HUMAN3.079e-2067.19Putative 40S ribosomal protein S26-like 1 OS=Homo ... [more]
RS26A_SCHPO2.607e-1963.4940S ribosomal protein S26-A OS=Schizosaccharomyces... [more]
RS26B_YEAST2.207e-1867.1940S ribosomal protein S26-B OS=Saccharomyces cerev... [more]
RS26A_YEAST2.207e-1867.1940S ribosomal protein S26-A OS=Saccharomyces cerev... [more]
RS26_DICDI3.764e-1858.2140S ribosomal protein S26 OS=Dictyostelium discoid... [more]
RS26_OXYNO3.297e-1453.9740S ribosomal protein S26 OS=Oxytricha nova GN=RPS... [more]
RS26_ENCCU1.061e-1247.5440S ribosomal protein S26 OS=Encephalitozoon cunic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402B03EF CTVClemen1 Citrus clementina cDNA clone C31402B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875271 ID=FC875271|Name=FC875271|organism=Citrus clementina|type=EST|length=665bp
GGAACAACCCTGACCCTCTGAAACAACAAGCAGCAGCGGCGCAACAAAAA
CAACAACAAGATGACGTTCAAGCGGAGGAACGGAGGAAGGAACAAGCACG
GCCGTGGCCACGTCAAGTTCATCCGCTGCTCTAACTGCGGCAAATGCTGC
CCTAAGGACAAGGCGATTAAGAGGTTTTTGGTGAGGAACATTGTTGAGCA
AGCTGCTGTTAGGGATGTTCAGGAGGCGTGTGTTTATGACGGTTACACTC
TTCCTAAGTTATATGCTAAGATGCAGTACTGCGTCTCGTGTGCGATCCAC
TCTCATGTGGTGAGAGTTCGTTCCCGTACTAACAGGAGGATCCGTGAGCC
CCCGCAACGCTTCAGGCGCAGGGATGATGTCCCAAAGGCTGGTGGTGCTC
TTGGTCAAGGCCCACGAGCTGGTGGTCCAGCTGGAGCTCCAGCTGCTGCT
CGTGCTTGAAAGCTTTCTGCTGTCAGTGCTTCTGGTCCTTTGAGGCTTTT
GAGATTTTTATGTGGTGGTATCAGATATGTGGGTCTGTTTAATTAGAGCA
CTGCAAACTTTTATGTTAGTTTTGTGTTTTGTTGTCATGCATCAGAGAAC
TGTTTACTGTCAAAAGTTTGAATCAAAACCCTAGAGAATTTTGATGGAGT
GATTGAAGTAAAATT
back to top