FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_HORSE (Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_BOVIN (Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_PUCGR (Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 187/234 (79.91%), Postives = 209/234 (89.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGD+AKNQVAMNP NTVFDAKRLIGR+F+DA VQ D+K +PF V      KP I V Y+GE+K+F+ EEISSM+L KM+E+AE+YLG T+ +AVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK  +VGE+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+VNHFVQEFKRK + D+S NPRALRRLRTA
Sbjct:   34 RTTPSYVAFTDTERLIGDSAKNQVAMNPHNTVFDAKRLIGRKFADAEVQSDIKHFPFTVF-DKGGKPYIRVQYRGEDKEFSPEEISSMILTKMKEVAESYLGGTVTSAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--TVGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFKRKHKKDLSSNPRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7D_MANSE (Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.048e-101
Identity = 185/234 (79.06%), Postives = 208/234 (88.89%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDT+RLIGDAAKNQVAMNP NT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG T++NAV+TVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK + D++ N RALRRLRTA
Sbjct:   36 RTTPSYVAFTDTDRLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGS--GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS7C2_DICDI (Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.048e-101
Identity = 185/234 (79.06%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV F +TERLIGDAAKNQVAMNPTNT+FDAKRLIGR+FSD  +Q DMK WPFKVIA   DKP + V +KGE K F+ EE+SSMVL+KM+E AEAYLG TI NAV+TVPAYFNDSQRQATKDAG IA LNV RIINEPTAAAIAYGL+KK  S GE+N+LIFDLGGGTFDVSLLTIE+G+FEVKATAGDTHLGGEDFDNR+VNHFV EFKRK + D+  N RALRRLRTA
Sbjct:   34 RTTPSYVAFNETERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFSDPVIQSDMKHWPFKVIAKEGDKPHLQVEFKGEVKTFSPEEVSSMVLLKMKETAEAYLGKTINNAVITVPAYFNDSQRQATKDAGAIAKLNVQRIINEPTAAAIAYGLEKK--SQGERNILIFDLGGGTFDVSLLTIEDGVFEVKATAGDTHLGGEDFDNRLVNHFVDEFKRKHKKDLMTNQRALRRLRTA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_CRIGR (Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 3.049e-101
Identity = 188/234 (80.34%), Postives = 203/234 (86.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKR  + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGEAKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRNDKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tschawytscha GN=hsp70 PE=2 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 3.049e-101
Identity = 187/234 (79.91%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMK WPFKV++    KP + V+YKGE K F  EEISSMVL+KMREIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYG+DK  +   E+NVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFNDQVVQADMKHWPFKVVSD-GGKPKVQVDYKGENKSFNPEEISSMVLVKMREIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGMDKGMSR--ERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRALRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71B_MOUSE (Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3)

HSP 1 Score: 367.851 bits (943), Expect = 3.049e-101
Identity = 186/234 (79.49%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F DA VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVV-NDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71A_MOUSE (Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 3.049e-101
Identity = 186/234 (79.49%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F DA VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVV-NDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_SCHPO (Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe GN=ssa2 PE=1 SV=3)

HSP 1 Score: 367.466 bits (942), Expect = 3.982e-101
Identity = 187/234 (79.91%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+F D  VQ DMK WPFKVI+    KP++ V YKGE K F  EEISSMVL+KMRE AEAYLG  + +AVVTVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLD+  ++ GE NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD+R+VNHF+QEFKRK + DI+GN RA+RRLRTA
Sbjct:   34 RTTPSYVAFTDTERLIGDAAKNQVAMNPHNTIFDAKRLIGRKFDDPEVQSDMKHWPFKVISKDG-KPVLQVEYKGETKTFTPEEISSMVLMKMRETAEAYLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDR--SNQGESNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDSRLVNHFIQEFKRKNKKDITGNARAVRRLRTA 264          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7C_HORSE8.023e-10280.77Heat shock cognate 71 kDa protein OS=Equus caballu... [more]
HSP7C_BOVIN8.023e-10280.77Heat shock cognate 71 kDa protein OS=Bos taurus GN... [more]
HSP71_PUCGR8.023e-10279.91Heat shock protein HSS1 OS=Puccinia graminis GN=HS... [more]
HSP7D_MANSE1.048e-10179.06Heat shock 70 kDa protein cognate 4 OS=Manduca sex... [more]
HS7C2_DICDI1.048e-10179.06Heat shock cognate 70 kDa protein 2 OS=Dictyosteli... [more]
HSP7C_CRIGR3.049e-10180.34Heat shock cognate 71 kDa protein OS=Cricetulus gr... [more]
HSP70_ONCTS3.049e-10179.91Heat shock 70 kDa protein OS=Oncorhynchus tschawyt... [more]
HS71B_MOUSE3.049e-10179.49Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hs... [more]
HS71A_MOUSE3.049e-10179.49Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hs... [more]
HSP72_SCHPO3.982e-10179.91Probable heat shock protein ssa2 OS=Schizosaccharo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top