FC875563
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: DRE2G_ARATH (Dehydration-responsive element-binding protein 2G OS=Arabidopsis thaliana GN=DREB2G PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 8.600e-12 Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 2 Query: 317 YRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILN 481 +RGVR R WGKWV+EIREP + +R+WLGTF+T AA A+D AA + G A LN Sbjct: 34 FRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVEAAMAYDEAAKKLYGHEAKLN 88
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: ERF88_ARATH (Ethylene-responsive transcription factor ERF088 OS=Arabidopsis thaliana GN=ERF088 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.467e-11 Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 2 Query: 266 AAKKQKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 484 ++ K+K + + Y GVR R WG++ +EIR P K R WLGTF T E AA A+DVAA SI G+ A NF Sbjct: 4 SSNKRKSKEEKKLQEGKYLGVRRRPWGRYAAEIRNPFTKERHWLGTFDTAEEAAFAYDVAARSISGSLATTNF 76
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: DRE2E_ARATH (Dehydration-responsive element-binding protein 2E OS=Arabidopsis thaliana GN=DREB2E PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.467e-11 Identity = 40/87 (45.98%), Postives = 52/87 (59.77%), Query Frame = 2 Query: 269 AKKQKKRPRDDSKHPV--YRGVRMRAWGKWVSEIREP--------RKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNFPKLAG 499 +KK R + ++PV +RGVR R WGKWV+EIREP + R+WLGTF+T AA A+D AA + G A LNFP+ G Sbjct: 52 SKKGCMRGKGGPENPVCRFRGVRQRVWGKWVAEIREPVSHRGANSSRSKRLWLGTFATAAEAALAYDRAASVMYGPYARLNFPEDLG 138
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: ESR1_ARATH (Ethylene-responsive transcription factor ESR1 OS=Arabidopsis thaliana GN=ESR1 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.916e-11 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 2 Query: 317 YRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 484 YRGVR R WG++ +EIR+P K R WLGTF T E AA A+D AA + +GA A NF Sbjct: 57 YRGVRRRPWGRYAAEIRDPMSKERRWLGTFDTAEQAACAYDSAARAFRGAKARTNF 112
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: ERF92_ARATH (Ethylene-responsive transcription factor 1B OS=Arabidopsis thaliana GN=ERF1B PE=2 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 2.502e-11 Identity = 33/57 (57.89%), Postives = 43/57 (75.44%), Query Frame = 2 Query: 317 YRGVRMRAWGKWVSEIREPRKKS-RIWLGTFSTPEMAARAHDVAALSIKGASAILNF 484 YRGVR R WGK+ +EIR+ + R+WLGTF + E AA A+D AA S++G+SAILNF Sbjct: 82 YRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNF 138
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: ERF1_SOLLC (Ethylene-responsive transcription factor 1 OS=Solanum lycopersicum GN=ERF1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.502e-11 Identity = 32/62 (51.61%), Postives = 43/62 (69.35%), Query Frame = 2 Query: 317 YRGVRMRAWGKWVSEIREPRKK-SRIWLGTFSTPEMAARAHDVAALSIKGASAILNFPKLAG 499 YRGVR R WGK+ +EIR+P K +R+WLGT+ + E AA A+ AA ++G A+LNFP G Sbjct: 107 YRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNFPHRIG 168
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: ERF87_ARATH (Ethylene-responsive transcription factor ERF087 OS=Arabidopsis thaliana GN=ERF087 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.268e-11 Identity = 36/83 (43.37%), Postives = 51/83 (61.45%), Query Frame = 2 Query: 272 KKQKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNFPKLAGSLPRPAS 520 ++ + +P+ + Y GVR R WG++ +EIR P K R WLGTF T E AA A+D AA SI+G +A NF + +PR +S Sbjct: 24 QQPQPQPQQHIEEIKYVGVRRRPWGRYAAEIRNPTTKERYWLGTFDTAEEAALAYDRAARSIRGLTARTNF--VYSDMPRGSS 104
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: LEP_ARATH (Ethylene-responsive transcription factor LEP OS=Arabidopsis thaliana GN=LEP PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.268e-11 Identity = 33/69 (47.83%), Postives = 44/69 (63.77%), Query Frame = 2 Query: 278 QKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 484 + K+ +DD + GVR R WG++ +EIR+P K R WLGTF T E AA A+D AA S++G A NF Sbjct: 7 KSKKKQDDQVGTRFLGVRRRPWGRYAAEIRDPTTKERHWLGTFDTAEEAALAYDRAARSMRGTRARTNF 75
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: RA211_ARATH (Ethylene-responsive transcription factor RAP2-11 OS=Arabidopsis thaliana GN=RAP2-11 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.280e-11 Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 2 Query: 275 KQKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 484 KQK + + + GVR R GKWV+EI++ +K R+WLGTF T E AARA+D AA ++G++ NF Sbjct: 8 KQKTKEKSKGNKTKFVGVRQRPSGKWVAEIKDTTQKIRMWLGTFETAEEAARAYDEAACLLRGSNTRTNF 77
BLAST of FC875563 vs. ExPASy Swiss-Prot
Match: ESR2_ARATH (Ethylene-responsive transcription factor ESR2 OS=Arabidopsis thaliana GN=ESR2 PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 9.508e-11 Identity = 31/56 (55.36%), Postives = 39/56 (69.64%), Query Frame = 2 Query: 317 YRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 484 YRGVR R WG++ +EIR+P K R WLGTF T E AA A+D AA +++G A NF Sbjct: 58 YRGVRRRPWGRYAAEIRDPLSKERRWLGTFDTAEEAACAYDCAARAMRGLKARTNF 113 The following BLAST results are available for this feature:
BLAST of FC875563 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 140
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC875563 ID=FC875563; Name=FC875563; organism=Citrus clementina; type=EST; length=648bpback to top |