FC875592

Overview
NameFC875592
Unique NameFC875592
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:372..1041. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: LH18_EUGGR (Light-harvesting complex I LH38 proteins (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.571e-14
Identity = 58/141 (41.13%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  242 PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPL---GEVTDPLYPGGSFDPLGLADD 655
            PP YLTGE  GD G+D AGL+ADP TF + +  EV HCR +ML  +GC+ PELL       G   WF    QI+ +  +D+          +  A+ A QVV    +E +R  GG L    E  D  YPG  FDPL L  +
Sbjct:  380 PPRYLTGEAYGDKGFDPAGLAADPVTFERMQVAEVFHCRLSMLALVGCLVPELL-------GNGAWF----QIWDK--VDF----------NRFAVVALQVV--APLEYWRGNGGFLWNDEETVDQSYPG--FDPLNLTTE 493          

HSP 2 Score: 77.411 bits (189), Expect = 7.482e-14
Identity = 52/144 (36.11%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  233 SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGG---PLGEVTDPLYPGGSFDPLGLADD 655
            + EPP+ LTGE+P D G+D   L+ADP+ +A+ R  EV H R AML  +GC+ PELL       G+  WF+AG  +                    L +    + +    E +R  GG     GE+ D  YPG  FDPL L  D
Sbjct:  193 NAEPPALLTGEYPADRGFDPLNLAADPDVYARMRVAEVFHGRLAMLCTVGCIVPELL-------GKGAWFEAGDSVDG------------------LKLGFITMAIAAPTEYWRGQGGFNWQKGEL-DRSYPG--FDPLNLTTD 308          

HSP 3 Score: 68.1662 bits (165), Expect = 4.539e-11
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  245 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG-YRIAGGPLGEVTDP--LYPGGSFDPLGLADD 655
            PS+L GE+ GD G+D AGL+ADP+TF + R  EV H R AML  +G + P+ L       G+ +W++A                          I   +V +  A  G + +A G + E +DP  +YPG  FDPL L  D
Sbjct:   12 PSWLNGEYYGDRGFDPAGLAADPDTFERMRIAEVYHGRLAMLAVVGALVPDYL-------GKGIWYEAAQN---------------------AGIGLKEVAIFTAAYGVFEVARG-VKENSDPTTIYPG--FDPLNLTTD 120          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB21_EUGGR (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.571e-14
Identity = 41/60 (68.33%), Postives = 46/60 (76.67%), Query Frame = 2
Query:  497 SLIHAQSILAIWACQVVLMGAVEGYRI---AGGPLGEVTDPLYPGGSFDPLGLADDPEAF 667
            +LIHA+S+LAI A QV+LMGAVEGYR    A G  GE  D LYPGG FDPLGLADDP+ F
Sbjct:    4 ALIHAKSLLAILATQVLLMGAVEGYRAGNTAPGQFGEDLDRLYPGGPFDPLGLADDPDTF 63          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.661e-11
Identity = 50/144 (34.72%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  245 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG-AQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG---YRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA 664
            P YLTG   GD G+D  GL+ DPE      + E+++ RWAMLG  G + PE+  + G+      W+ AG  Q F+     ++    L H   I   W   +   G+V     ++    P GEV    YPGG F+PL  A   EA
Sbjct:   64 PDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI-INVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRR-WQ-DIKNPGSVNQDPIFKQYSLPKGEVG---YPGGIFNPLNFAPTQEA 201          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.475e-11
Identity = 50/144 (34.72%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  245 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG-AQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG---YRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA 664
            P YLTG  PGD G+D  GL+ DPE      + E+++ RWAMLG  G + PE+    G+      W+ AG  + F+     ++    L H   I   W   +   G+V     ++    P GEV    YPGG F+PL  A   EA
Sbjct:   63 PGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGI-INVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRR-WQ-DIKNPGSVNQDPIFKQYSLPAGEVG---YPGGIFNPLNFAPTLEA 200          
The following BLAST results are available for this feature:
BLAST of FC875592 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
LH18_EUGGR2.571e-1441.13Light-harvesting complex I LH38 proteins (Fragment... [more]
CB21_EUGGR2.571e-1468.33Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB24_ARATH2.661e-1134.72Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB24_PEA3.475e-1134.72Chlorophyll a-b binding protein P4, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F06EF CTVClemen1 Citrus clementina cDNA clone C31405F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875592 ID=FC875592|Name=FC875592|organism=Citrus clementina|type=EST|length=670bp
ACCTCTCAACACTCGAACACTAGAGCCCACCAACAACTCTGATCATTGCA
AAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGCT
GTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCTC
CATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTACG
GCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAGC
TACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGCT
TTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATCC
ACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCTC
TTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGGG
AGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGCT
TGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTTG
ATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAGT
GACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCTG
ATGACCCGGAGGCTTTTGCT
back to top