FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCLB (Adenosylhomocysteinase OS=Mycobacterium leprae (strain Br4923) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.074e-47
Identity = 98/183 (53.55%), Postives = 122/183 (66.67%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FKV DLS A+FGR E++LAE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  GV+    YEK G +P     D AE+++ L ++R
Sbjct:   14 NGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMILDDGGDATMLVLRGVQ----YEKAGVVPPAEVDDSAEWKVFLNLLR 192          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCBO (Adenosylhomocysteinase OS=Mycobacterium bovis GN=ahcY PE=1 SV=3)

HSP 1 Score: 186.422 bits (472), Expect = 1.054e-46
Identity = 97/183 (53.01%), Postives = 121/183 (66.12%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE++I L ++R
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKIFLNLLR 195          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCTU (Adenosylhomocysteinase OS=Mycobacterium tuberculosis GN=ahcY PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.377e-46
Identity = 96/183 (52.46%), Postives = 121/183 (66.12%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L ++R
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNLLR 195          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCTA (Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.377e-46
Identity = 96/183 (52.46%), Postives = 121/183 (66.12%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L ++R
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNLLR 195          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCBT (Adenosylhomocysteinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.377e-46
Identity = 96/183 (52.46%), Postives = 121/183 (66.12%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L ++R
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNLLR 195          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCBP (Adenosylhomocysteinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.377e-46
Identity = 96/183 (52.46%), Postives = 121/183 (66.12%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L ++R
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNLLR 195          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCSS (Adenosylhomocysteinase OS=Mycobacterium sp. (strain MCS) GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.799e-46
Identity = 96/186 (51.61%), Postives = 122/186 (65.59%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRD 628
            +S +G ++KV DLS A+FGR EI LAE EMPGLMA R E+    P KGA+I+GSLHMT+QTAVLIETL +LGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P     D AE+++ L ++R+
Sbjct:   11 ESRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPAEDDDSAEYKVFLNLLRE 191          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCSK (Adenosylhomocysteinase OS=Mycobacterium sp. (strain KMS) GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.799e-46
Identity = 96/186 (51.61%), Postives = 122/186 (65.59%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRD 628
            +S +G ++KV DLS A+FGR EI LAE EMPGLMA R E+    P KGA+I+GSLHMT+QTAVLIETL +LGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P     D AE+++ L ++R+
Sbjct:   11 ESRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPAEDDDSAEYKVFLNLLRE 191          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCSJ (Adenosylhomocysteinase OS=Mycobacterium sp. (strain JLS) GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.799e-46
Identity = 96/186 (51.61%), Postives = 122/186 (65.59%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRD 628
            +S +G ++KV DLS A+FGR EI LAE EMPGLMA R E+    P KGA+I+GSLHMT+QTAVLIETL +LGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P     D AE+++ L ++R+
Sbjct:   11 ESRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPAEDDDSAEYKVFLNLLRE 191          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DESVV (Adenosylhomocysteinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.349e-46
Identity = 95/182 (52.20%), Postives = 119/182 (65.38%), Query Frame = 2
Query:   83 ALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA----STDYAEFQIVL 613
            A   QK     + KV D+S AD+GR +++L+E EMPGLM    ++G ++P KG K+TGSLHMTIQTA+LI TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL IH+GV+ E          DP+    + D  EFQI++
Sbjct:    4 AKRAQKLDLSLDHKVADMSLADYGRKDLQLSEREMPGLMELIRKYGGTKPLKGLKVTGSLHMTIQTAMLIRTLYELGADIRWASCNIFSTQDHAAAAIAASGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLFIHKGVEVEN---------DPSLLKKAYDNKEFQIIM 176          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_MYCLB8.074e-4753.55Adenosylhomocysteinase OS=Mycobacterium leprae (st... [more]
SAHH_MYCBO1.054e-4653.01Adenosylhomocysteinase OS=Mycobacterium bovis GN=a... [more]
SAHH_MYCTU1.377e-4652.46Adenosylhomocysteinase OS=Mycobacterium tuberculos... [more]
SAHH_MYCTA1.377e-4652.46Adenosylhomocysteinase OS=Mycobacterium tuberculos... [more]
SAHH_MYCBT1.377e-4652.46Adenosylhomocysteinase OS=Mycobacterium bovis (str... [more]
SAHH_MYCBP1.377e-4652.46Adenosylhomocysteinase OS=Mycobacterium bovis (str... [more]
SAHH_MYCSS1.799e-4651.61Adenosylhomocysteinase OS=Mycobacterium sp. (strai... [more]
SAHH_MYCSK1.799e-4651.61Adenosylhomocysteinase OS=Mycobacterium sp. (strai... [more]
SAHH_MYCSJ1.799e-4651.61Adenosylhomocysteinase OS=Mycobacterium sp. (strai... [more]
SAHH_DESVV2.349e-4652.20Adenosylhomocysteinase OS=Desulfovibrio vulgaris s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top