FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RALPJ (Adenosylhomocysteinase OS=Ralstonia pickettii (strain 12J) GN=ahcY PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.557e-45
Identity = 88/143 (61.54%), Postives = 104/143 (72.73%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            ++ V D+  AD+GR EI +AE EMPGLMA R EF  SQP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH              +KGE+LQEYW  T +  +W  GG P++I+DDGGDATLL+H G KAE+
Sbjct:   10 DYLVADIKLADWGRKEIAIAETEMPGLMAIRDEFAASQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAATGTPVFAFKGESLQEYWDFTHRIFEWADGGTPNMILDDGGDATLLLHLGAKAEK 152          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_HYPNA (Adenosylhomocysteinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ahcY PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.557e-45
Identity = 88/146 (60.27%), Postives = 108/146 (73.97%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            A+ +++ VKD+S A++GR EI +AE EMPGLMA R EFGPSQP KGA+I GSLHMTIQTAVLI+TL ALGA+VRW SCNI+STQDH              +KGETL+EYW  T++   W  G GP+LI+DDGGDAT+ +  G KAE
Sbjct:    5 AAPQDYFVKDISLAEYGRKEIAIAETEMPGLMAAREEFGPSQPLKGARICGSLHMTIQTAVLIQTLEALGAQVRWVSCNIYSTQDHAAAAIADAGTAVFAYKGETLEEYWDYTDRMFQWPDGEGPNLILDDGGDATMYLILGEKAE 150          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CAUCR (Adenosylhomocysteinase OS=Caulobacter crescentus GN=ahcY PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.557e-45
Identity = 92/143 (64.34%), Postives = 103/143 (72.03%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            ++ VKD+S ADFGR EI +AE EMPGLMA RAE+GP Q  KGA+I GSLHMTIQTAVLIETLTALGAEVRW SCNIFSTQDH              +KGE L EYW    K  +W  GG P+LI+DDGGDATLL   G KAE+
Sbjct:    3 DYIVKDISLADFGRKEIAIAETEMPGLMATRAEYGPQQILKGARIAGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAFKGENLVEYWEYAHKIFEWHDGGYPNLILDDGGDATLLCVLGPKAEK 145          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PELCD (Adenosylhomocysteinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 9.869e-45
Identity = 95/164 (57.93%), Postives = 114/164 (69.51%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIV 610
            + VKD+  A++GR EI +AE EMPGLMA R E+  ++P  GA+ITGSLHMTIQTAVLIETL  LGA++RW SCNI+STQDH              +KGETL+EYW  T KAL +    GP LIVDDGGDATLLIH GV+ E  Y +TGK+P+  S D  E  IV
Sbjct:   10 YVVKDMGLAEWGRREIRMAEAEMPGLMAIREEYRGTKPLAGARITGSLHMTIQTAVLIETLAELGADLRWASCNIYSTQDHAAAAIAATGVPVFAYKGETLEEYWEYTFKALAYEE--GPQLIVDDGGDATLLIHRGVERERAYARTGKVPE-ISHDNKELSIV 170          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHOP2 (Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain HaA2) GN=ahcY PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.289e-44
Identity = 92/171 (53.80%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNI+STQDH               KGE+L++YW  T +  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLVALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAIKGESLEDYWDYTARMFDWHGGGTPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPGSDEEVIFFALL 170          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RALSO (Adenosylhomocysteinase OS=Ralstonia solanacearum GN=ahcY PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.683e-44
Identity = 87/143 (60.84%), Postives = 104/143 (72.73%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            ++ V D+  AD+GR EI +AE EMPGLMA R EF  SQP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH              +KGE+L+EYW  T +  +W  GG P++I+DDGGDATLL+H G KAE+
Sbjct:   10 DYLVADIKLADWGRKEIAIAETEMPGLMAIRDEFAASQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTPVFAFKGESLKEYWDFTHRIFEWADGGTPNMILDDGGDATLLLHLGAKAEQ 152          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_AGRRK (Adenosylhomocysteinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ahcY PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.683e-44
Identity = 97/175 (55.43%), Postives = 116/175 (66.29%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLKA 640
            ++ V D+  ADFGR EI +AE EMPGLMACRAEFG ++P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGE+L++YW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE        L DP S    E +I+   I+  LKA
Sbjct:    6 DYIVADIGLADFGRKEITIAETEMPGLMACRAEFGETKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVYAIKGESLEDYWIYTDKIFQWADGGFSNMILDDGGDATMYILLGARAE---AGEDVLSDPHS---EEEEILFAQIKKRLKA 174          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METNO (Adenosylhomocysteinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ahcY PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.872e-44
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            S +++ V+D+  ADFGR EI +AE EMPGLMA R E+  SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  +W  GG P++I+DDGGDAT+ +H G++AE
Sbjct:    3 SAQDYIVRDIGLADFGRKEIAIAETEMPGLMAVRREYAASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTAKLFEWHDGGMPNMILDDGGDATMFVHAGLRAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHIEC (Adenosylhomocysteinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ahcY PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.397e-44
Identity = 86/143 (60.14%), Postives = 104/143 (72.73%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +++ V D+  ADFGR EI +AE EMPGLM+CRAEFG ++P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGE+L++YW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    5 KDYVVADIGLADFGRKEITIAETEMPGLMSCRAEFGEAKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAIKGESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHIE6 (Adenosylhomocysteinase OS=Rhizobium etli (strain CIAT 652) GN=ahcY PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.397e-44
Identity = 86/143 (60.14%), Postives = 104/143 (72.73%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +++ V D+  ADFGR EI +AE EMPGLM+CRAEFG ++P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGE+L++YW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    5 KDYVVADIGLADFGRKEITIAETEMPGLMSCRAEFGDAKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAIKGESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAE 147          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_RALPJ7.557e-4561.54Adenosylhomocysteinase OS=Ralstonia pickettii (str... [more]
SAHH_HYPNA7.557e-4560.27Adenosylhomocysteinase OS=Hyphomonas neptunium (st... [more]
SAHH_CAUCR7.557e-4564.34Adenosylhomocysteinase OS=Caulobacter crescentus G... [more]
SAHH_PELCD9.869e-4557.93Adenosylhomocysteinase OS=Pelobacter carbinolicus ... [more]
SAHH_RHOP21.289e-4453.80Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_RALSO1.683e-4460.84Adenosylhomocysteinase OS=Ralstonia solanacearum G... [more]
SAHH_AGRRK1.683e-4455.43Adenosylhomocysteinase OS=Agrobacterium radiobacte... [more]
SAHH_METNO2.872e-4459.31Adenosylhomocysteinase OS=Methylobacterium nodulan... [more]
SAHH_RHIEC6.397e-4460.14Adenosylhomocysteinase OS=Rhizobium etli (strain C... [more]
SAHH_RHIE66.397e-4460.14Adenosylhomocysteinase OS=Rhizobium etli (strain C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top