FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_ARATH (Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 5.614e-96
Identity = 152/180 (84.44%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            +++ EIR AQRADGPA +LAIGTA P + V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LKENP+MCAYMAPSLD RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 SSLDEIRQAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIAKDLAENN 186          

HSP 2 Score: 54.6842 bits (130), Expect = 5.614e-96
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDS 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_IPOBA (Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 5.614e-96
Identity = 154/181 (85.08%), Postives = 166/181 (91.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.2174 bits (121), Expect = 5.614e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL+VCSEIT VTFRGP++THLDS
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 5.615e-96
Identity = 155/181 (85.64%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+++EIR AQRADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 44.2838 bits (103), Expect = 5.615e-96
Identity = 20/27 (74.07%), Postives = 23/27 (85.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITA+ FRGP +  LDS
Sbjct:  182 KGARVLVVCSEITAICFRGPTEAALDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_MEDSA (Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 7.325e-96
Identity = 151/181 (83.43%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT++AIGTA P++ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPSNCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 7.325e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 7.325e-96
Identity = 153/181 (84.53%), Postives = 166/181 (91.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA P + V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPPNRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 7.325e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.556e-96
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH  ELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKIELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 9.556e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_PEA (Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.556e-96
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR  QRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKPQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 9.556e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 1.626e-95
Identity = 153/178 (85.96%), Postives = 169/178 (94.94%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            V+ IR AQRA+GPAT+LAIGTATPA+ V QADYPDYYFR+T+SEHM +LKEKF+RMCDKSMI+KRYM++TEE LKENP+MC +MAPSLDARQD+VVVEVPKLGKEAATKAIKEWG PKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:   10 VETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTESEHMVDLKEKFQRMCDKSMIRKRYMHITEEFLKENPSMCKFMAPSLDARQDLVVVEVPKLGKEAATKAIKEWGFPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 187          

HSP 2 Score: 49.2914 bits (116), Expect = 1.626e-95
Identity = 23/27 (85.19%), Postives = 25/27 (92.59%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP + HLDS
Sbjct:  188 KGARVLVVCSEITAVTFRGPNEGHLDS 214          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.626e-95
Identity = 154/181 (85.08%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPAT+LAIGTATPA+ V+Q+ YPDYYFRIT S+HMT+LK+KF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENN 181          

HSP 2 Score: 48.1358 bits (113), Expect = 1.626e-95
Identity = 22/27 (81.48%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            + ARVLVVCSEIT VTFRGP +THLDS
Sbjct:  182 KAARVLVVCSEITVVTFRGPNETHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 2.122e-95
Identity = 152/180 (84.44%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A ++EIR  QRA GPA +LAIGTATP++ V QADYPDYYFRIT SEHM++LK KFKRMC+KSMI+KRYM++TEE LKENPN+CAY APSLDARQD+VVVEVP+LGKEAA KAIKEWG PKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    6 AEIEEIRKRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMSDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAAAKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 185          

HSP 2 Score: 52.7582 bits (125), Expect = 2.122e-95
Identity = 24/26 (92.31%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGP+D+HLDS
Sbjct:  187 GARVLVVCSEITAVTFRGPSDSHLDS 212          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_ARATH5.614e-9684.44Chalcone synthase OS=Arabidopsis thaliana GN=CHS P... [more]
CHS2_IPOBA5.614e-9685.08Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_DIAMO5.615e-9685.64Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS3_MEDSA7.325e-9683.43Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1... [more]
CHS1_TRISU7.325e-9684.53Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHS4_PEA9.556e-9683.98Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS1_PEA9.556e-9683.98Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 ... [more]
CHS3_GERHY1.626e-9585.96Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]
CHSD_IPONI1.626e-9585.08Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]
CHS2_DAUCA2.122e-9584.44Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top