FC876280
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC876280 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1) HSP 1 Score: 109.768 bits (273), Expect = 5.832e-24 Identity = 50/59 (84.75%), Postives = 56/59 (94.92%), Query Frame = 2 Query: 281 LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGV 457 LKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV Sbjct: 1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGV 59
BLAST of FC876280 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.541e-11 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = 2 Query: 365 LGKEAATKAIKEWGQPKSKITHLIFCTTSGVD 460 LGKEAA KAIKEWGQPKSKITHLIFCTTSGVD Sbjct: 1 LGKEAAVKAIKEWGQPKSKITHLIFCTTSGVD 32 The following BLAST results are available for this feature:
BLAST of FC876280 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 142
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC876280 ID=FC876280; Name=FC876280; organism=Citrus clementina; type=EST; length=461bpback to top |