FC876316

Overview
NameFC876316
Unique NameFC876316
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length298
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:13..310. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS6_SORBI (Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.392e-35
Identity = 68/82 (82.93%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMTELKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.392e-35
Identity = 68/82 (82.93%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMTELKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS4_SORBI (Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.392e-35
Identity = 68/82 (82.93%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMTELKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.392e-35
Identity = 68/82 (82.93%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMTELKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.392e-35
Identity = 68/82 (82.93%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMTELKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 5.736e-35
Identity = 66/82 (80.49%), Postives = 77/82 (93.90%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+RNAQRA+GPATVLAIGTATPA+   QADYPDYYF+ITKS+HM +LKEKF+RMCDKS I+KR+MHLTEEIL+ENPNMC
Sbjct:    6 TVEEVRNAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILEENPNMC 87          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 9.785e-35
Identity = 67/82 (81.71%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMT+LKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 9.785e-35
Identity = 67/82 (81.71%), Postives = 75/82 (91.46%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA GPATVLAIGTATPA+  +QADYPDYYFRITKSEHMT+LKEKF+RMCDKS I+KR+MHLTEE L ENPNMC
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSJ_PETHY (Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 1.278e-34
Identity = 66/84 (78.57%), Postives = 77/84 (91.67%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+EIR AQRA+GPAT++AIGTATP++  +Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKR+MHLTEEILKENPN+C
Sbjct:    1 MVTVEEIRRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPNIC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSD_PETHY (Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 1.278e-34
Identity = 66/84 (78.57%), Postives = 78/84 (92.86%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+RNAQRA+GPATVLAIGTATP++  +Q+ YPDYYFRIT SEH TELKEKF+R+CDKSMIKKR+MHLTE+ILKENPN+C
Sbjct:    1 MVTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRICDKSMIKKRYMHLTEKILKENPNIC 84          
The following BLAST results are available for this feature:
BLAST of FC876316 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHS6_SORBI4.392e-3582.93Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=... [more]
CHS5_SORBI4.392e-3582.93Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHS4_SORBI4.392e-3582.93Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=... [more]
CHS2_SORBI4.392e-3582.93Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]
CHS1_SORBI4.392e-3582.93Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
CHS1_HORVU5.736e-3580.49Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]
CHS7_SORBI9.785e-3581.71Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]
CHS3_SORBI9.785e-3581.71Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHSJ_PETHY1.278e-3478.57Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=... [more]
CHSD_PETHY1.278e-3478.57Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C08EF DevOvary1 Citrus clementina cDNA clone C32003C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876316 ID=FC876316|Name=FC876316|organism=Citrus clementina|type=EST|length=298bp
ACCAAGCACGAGCCACCCACATATTCATTAAGGGTTCAACTTGAAATGGC
AACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGCCACCG
TCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGCCAACCAGGCTGAT
TATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACGGAGCT
TAAAGAGAAGTTCAGGCGCATGTGTGACAAGTCGATGATTAAGAAGCGCC
ACATGCACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGTGCG
back to top