FC876324

Overview
NameFC876324
Unique NameFC876324
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length551
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9430 contig Ccv1_Contig9430:32..581. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_ARATH (Fructose-1,6-bisphosphatase, cytosolic OS=Arabidopsis thaliana GN=At1g43670 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.411e-16
Identity = 46/100 (46.00%), Postives = 67/100 (67.00%), Query Frame = 2
Query:  254 EIETLTNWLLKQEQSGVIDA--ELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            ++ T+T ++L  EQS   ++  + TI+LS I   CK + S V +AG++ L G+ G  N+QGE+QKKLDV SN+VF N L SSGRT ++ SEE++    VE
Sbjct:   11 DLMTITRFVLN-EQSKYPESRGDFTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNDVFVNALVSSGRTSVLVSEEDEEATFVE 109          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_SPIOL (Fructose-1,6-bisphosphatase, cytosolic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 5.372e-16
Identity = 44/99 (44.44%), Postives = 64/99 (64.65%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            ++ T+T ++L +Q +      + TI+LS I   CK + S V +AG++ L G+ G  N+QGE+QKKLDV SNEVF   L SSGRT I+ SEE++    +E
Sbjct:   11 DLMTITRYVLNEQSKRPESRGDFTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNEVFVKALTSSGRTCILVSEEDEEATFIE 109          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_PEA (Fructose-1,6-bisphosphatase, cytosolic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.372e-16
Identity = 44/99 (44.44%), Postives = 64/99 (64.65%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            ++ T+T ++L +Q +      + TI+LS I   CK + S V +AG++ L G+ G  N+QGE+QKKLDV SNEVF   L SSGRT I+ SEE++    +E
Sbjct:   11 DLMTITRYVLNEQSKRPESRGDFTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNEVFVKALTSSGRTCILVSEEDEEATFIE 109          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_SACHY (Fructose-1,6-bisphosphatase, cytosolic OS=Saccharum hybrid GN=CFBP PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 9.162e-16
Identity = 44/93 (47.31%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            ++ T+T  +L +Q ++     + TI+LS I   CK +AS V +AG++ L G+ G  NVQGE+QKKLDV SNEVF   L SSGRT ++ SEE++
Sbjct:   11 DLMTITRHVLNEQSRNPESRGDFTILLSHIVLGCKFVASAVNKAGLAQLIGLAGETNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEEDE 103          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_BRANA (Fructose-1,6-bisphosphatase, cytosolic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.162e-16
Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 2
Query:  254 EIETLTNWLLKQEQSGVIDA--ELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            ++ T+T ++L  EQS   ++  + TI+LS+I   CK + S V +AG++ L G+ G  N+QGE+QKKLDV SN+VF   L SSGRT ++ SEE++    VE
Sbjct:   10 DLMTITRFVLN-EQSKYPESRGDFTILLSNIVLGCKFVCSAVNKAGLAKLIGLAGDTNIQGEEQKKLDVLSNDVFVKALVSSGRTSVLVSEEDEEATFVE 108          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_BETVU (Fructose-1,6-bisphosphatase, cytosolic OS=Beta vulgaris PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 1.563e-15
Identity = 44/99 (44.44%), Postives = 64/99 (64.65%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            ++ T+T ++L +Q +      + TI++S I   CK + S V +AG++ L G+ G  N+QGE+QKKLDV SNEVF   L SSGRT I+ SEE++    VE
Sbjct:   11 DLMTITRFVLNEQSKRPESRGDFTILMSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNEVFIKALISSGRTCILVSEEDEEATFVE 109          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_SOLTU (Fructose-1,6-bisphosphatase, cytosolic OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.728e-14
Identity = 43/97 (44.33%), Postives = 62/97 (63.92%), Query Frame = 2
Query:  242 RSSYEIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            R   ++ T+T ++L +Q +      + +I+LS I   CK + + V +AG++ L G+ G  NVQGEDQKKLDV SNEVF   L SS RT I+ SEE++
Sbjct:    7 RHRTDLMTITRFVLNEQTKHPESRGDFSILLSHIVLGCKFVCTAVNKAGLAKLLGLAGETNVQGEDQKKLDVLSNEVFIKALVSSNRTCILVSEEDE 103          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_HUMAN (Fructose-1,6-bisphosphatase 1 OS=Homo sapiens GN=FBP1 PE=1 SV=4)

HSP 1 Score: 78.5666 bits (192), Expect = 2.257e-14
Identity = 41/98 (41.84%), Postives = 66/98 (67.35%), Query Frame = 2
Query:  254 EIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            ++ TLT +++++ +      ELT +L+S+ TA K I+S V++AGI++L GI G+ NV G+  KKLDV SN++  N L+SS  T ++ SEE+   + VE
Sbjct:   10 DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVE 107          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_MOUSE (Fructose-1,6-bisphosphatase 1 OS=Mus musculus GN=Fbp1 PE=2 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 3.849e-14
Identity = 41/98 (41.84%), Postives = 64/98 (65.31%), Query Frame = 2
Query:  254 EIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVE 547
            +I TLT ++++Q +      ELT +L+S+ TA K I+S V++AGI+ L GI G+ NV G+  KKLD+ SN++  N L+SS  T ++ SEE    + +E
Sbjct:   10 DISTLTRFVMEQGRKAQGTGELTQLLNSLCTAIKAISSAVRQAGIAQLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSYATCVLVSEENTNAIIIE 107          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_MOUSE (Fructose-1,6-bisphosphatase isozyme 2 OS=Mus musculus GN=Fbp2 PE=2 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 5.028e-14
Identity = 43/96 (44.79%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  242 RSSYEIE--TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEE 523
            RS +E +  TLT +++++ +      ELT +L+S+ TA K I+S V++AG++NL GI G+VNV G++ KKLDV SN +  N L+SS  T ++ SEE
Sbjct:    4 RSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLANLYGISGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEE 99          
The following BLAST results are available for this feature:
BLAST of FC876324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
F16P2_ARATH2.411e-1646.00Fructose-1,6-bisphosphatase, cytosolic OS=Arabidop... [more]
F16P2_SPIOL5.372e-1644.44Fructose-1,6-bisphosphatase, cytosolic OS=Spinacia... [more]
F16P2_PEA5.372e-1644.44Fructose-1,6-bisphosphatase, cytosolic OS=Pisum sa... [more]
F16P2_SACHY9.162e-1647.31Fructose-1,6-bisphosphatase, cytosolic OS=Saccharu... [more]
F16P2_BRANA9.162e-1645.00Fructose-1,6-bisphosphatase, cytosolic OS=Brassica... [more]
F16P2_BETVU1.563e-1544.44Fructose-1,6-bisphosphatase, cytosolic OS=Beta vul... [more]
F16P2_SOLTU1.728e-1444.33Fructose-1,6-bisphosphatase, cytosolic OS=Solanum ... [more]
F16P1_HUMAN2.257e-1441.84Fructose-1,6-bisphosphatase 1 OS=Homo sapiens GN=F... [more]
F16P1_MOUSE3.849e-1441.84Fructose-1,6-bisphosphatase 1 OS=Mus musculus GN=F... [more]
F16P2_MOUSE5.028e-1444.79Fructose-1,6-bisphosphatase isozyme 2 OS=Mus muscu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D06EF DevOvary1 Citrus clementina cDNA clone C32003D06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876324 ID=FC876324|Name=FC876324|organism=Citrus clementina|type=EST|length=551bp
GCGTAAAGCAGAAAGCAGAGGGCCAAAATGGTTGCAGCAGCAGCGACAGC
ATCATCACAGCTTCTCTTTTCAAGCTCTCACTCTTCTCTCTCGGCTCTCT
CCTTACCAAATATGTGTCTTCGACTCCAAAGCACTCGTGTCGTCATGTCC
CAGCAACGTTTTGAAGAGAAGACATGTTGGTGTTGCTGCTGGGGTTCGGT
GCATGGCTGTTGGGACAACATCGGAGGTTGCAACCAAGAAGAGAAGTTCG
TATGAGATTGAAACGCTGACAAACTGGCTGTTGAAGCAAGAACAGTCTGG
CGTTATTGATGCTGAGCTCACTATTGTGCTTTCCAGCATTTCAACGGCGT
GCAAGCAGATTGCTTCTTTGGTGCAAAGAGCTGGCATTTCCAACTTGACT
GGAATTCAGGGTGCTGTCAATGTTCAAGGCGAGGACCAGAAGAAGCTCGA
CGTCGCTTCAAATGAGGTGTTCTCAAACTGTTTGAGATCAAGTGGGCGAA
CCGGGATTATAGCGTCAGAGGAAGAGGATGTACCACTGGCGGTAGAAGAG
A
back to top