FC876324

Overview
NameFC876324
Unique NameFC876324
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length551
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9430 contig Ccv1_Contig9430:32..581. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_NITOC (Fructose-1,6-bisphosphatase class 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fbp PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.112e-12
Identity = 38/87 (43.68%), Postives = 56/87 (64.37%), Query Frame = 2
Query:  266 LTNWLLKQEQS-GVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEE 523
            LT ++L++++S      + T +L+ I TACK I+ LV R G+ ++ G  G  N+QGE QKKLDV SN++  N L  +G  G +ASEE
Sbjct:    7 LTQFILEEQRSIPSATGDFTGLLNDIVTACKTISHLVNRGGLIDILGAAGTENIQGEGQKKLDVISNDIMVNSLEWTGHLGAMASEE 93          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_XANOR (Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas oryzae pv. oryzae GN=fbp PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 6.146e-12
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  263 TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            +LT +L++++ +G IDAEL  +++ +S ACK+I+  V +  +  + G  G  NVQGE QKKLDV SN++        G     ASEE D    V E
Sbjct:    5 SLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGALGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMDHSQPVPE 100          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_XANOP (Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=fbp PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.146e-12
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  263 TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            +LT +L++++ +G IDAEL  +++ +S ACK+I+  V +  +  + G  G  NVQGE QKKLDV SN++        G     ASEE D    V E
Sbjct:    5 SLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGALGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMDHSQPVPE 100          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_XANOM (Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fbp PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.146e-12
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  263 TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            +LT +L++++ +G IDAEL  +++ +S ACK+I+  V +  +  + G  G  NVQGE QKKLDV SN++        G     ASEE D    V E
Sbjct:    5 SLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGALGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMDHSQPVPE 100          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_XANAC (Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas axonopodis pv. citri GN=fbp PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.027e-12
Identity = 36/89 (40.45%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  263 TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            +LT +L++++ +G IDAEL  +++ +S ACK+I+  V +  +  + G  G  NVQGE QKKLDV SN++        G     ASEE D
Sbjct:    5 SLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGALGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMD 93          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_HALHL (Fructose-1,6-bisphosphatase class 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=fbp PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.048e-11
Identity = 38/90 (42.22%), Postives = 55/90 (61.11%), Query Frame = 2
Query:  263 TLTNWLLKQEQS-GVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            TLTN++++ +++      E T +L+ IS ACK+IA LV +  +  + G   + NVQGE QKKLDV +NEVF   L  +G    + SEE D
Sbjct:    6 TLTNYIIETQRNLPEATGEFTGLLNDISVACKRIADLVNKGDLVGMLGSADSENVQGETQKKLDVVTNEVFIEALTQNGHIAGLVSEEMD 95          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_XANC5 (Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fbp PE=3 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 1.369e-11
Identity = 36/89 (40.45%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  263 TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            +LT +L++++ +G IDAEL  +++ +S ACK+I+  V +  +  + G  G  NVQGE QKKLDV SN++        G     ASEE D
Sbjct:    5 SLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGTLGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMD 93          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P_KLULA (Fructose-1,6-bisphosphatase OS=Kluyveromyces lactis GN=FBP1 PE=3 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.788e-11
Identity = 35/94 (37.23%), Postives = 61/94 (64.89%), Query Frame = 2
Query:  254 EIETLTNWLLKQEQSGVIDA--ELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            +I TL+ ++L Q+     +A  E +++L+S+  A K I+  ++RA + NL G+ GA N  G+ QKKLDV  +E+F N +++SG   ++ SEE++
Sbjct:   17 DIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQE 110          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_SHEAM (Fructose-1,6-bisphosphatase class 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fbp PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.335e-11
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  293 QSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED--VPLA 541
            +   I  EL  +L+ ++ + K I+  V+R  ++ + G+ G  NVQGEDQKKLDV +N++  + L + G    +ASEEED  VPLA
Sbjct:    9 KQSAISEELASLLTVLANSSKDISQAVRRGALAGVLGVAGTENVQGEDQKKLDVITNDMLKDALAAQGSVKALASEEEDEIVPLA 93          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16PA_XANCP (Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas campestris pv. campestris GN=fbp PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.050e-11
Identity = 35/89 (39.33%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  263 TLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            +LT +L++++ +G ID EL  +++ +S ACK+I+  V +  +  + G  G  NVQGE QKKLDV SN++        G     ASEE D
Sbjct:    5 SLTRFLIEEQHAGRIDPELRQLITIVSRACKRISIAVSKGALGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMD 93          
The following BLAST results are available for this feature:
BLAST of FC876324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
F16PA_NITOC2.112e-1243.68Fructose-1,6-bisphosphatase class 1 OS=Nitrosococc... [more]
F16PA_XANOR6.146e-1239.58Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas... [more]
F16PA_XANOP6.146e-1239.58Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas... [more]
F16PA_XANOM6.146e-1239.58Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas... [more]
F16PA_XANAC8.027e-1240.45Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas... [more]
F16PA_HALHL1.048e-1142.22Fructose-1,6-bisphosphatase class 1 OS=Halorhodosp... [more]
F16PA_XANC51.369e-1140.45Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas... [more]
F16P_KLULA1.788e-1137.23Fructose-1,6-bisphosphatase OS=Kluyveromyces lacti... [more]
F16PA_SHEAM2.335e-1141.18Fructose-1,6-bisphosphatase class 1 OS=Shewanella ... [more]
F16PA_XANCP3.050e-1139.33Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D06EF DevOvary1 Citrus clementina cDNA clone C32003D06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876324 ID=FC876324|Name=FC876324|organism=Citrus clementina|type=EST|length=551bp
GCGTAAAGCAGAAAGCAGAGGGCCAAAATGGTTGCAGCAGCAGCGACAGC
ATCATCACAGCTTCTCTTTTCAAGCTCTCACTCTTCTCTCTCGGCTCTCT
CCTTACCAAATATGTGTCTTCGACTCCAAAGCACTCGTGTCGTCATGTCC
CAGCAACGTTTTGAAGAGAAGACATGTTGGTGTTGCTGCTGGGGTTCGGT
GCATGGCTGTTGGGACAACATCGGAGGTTGCAACCAAGAAGAGAAGTTCG
TATGAGATTGAAACGCTGACAAACTGGCTGTTGAAGCAAGAACAGTCTGG
CGTTATTGATGCTGAGCTCACTATTGTGCTTTCCAGCATTTCAACGGCGT
GCAAGCAGATTGCTTCTTTGGTGCAAAGAGCTGGCATTTCCAACTTGACT
GGAATTCAGGGTGCTGTCAATGTTCAAGGCGAGGACCAGAAGAAGCTCGA
CGTCGCTTCAAATGAGGTGTTCTCAAACTGTTTGAGATCAAGTGGGCGAA
CCGGGATTATAGCGTCAGAGGAAGAGGATGTACCACTGGCGGTAGAAGAG
A
back to top