FC920180

Overview
NameFC920180
Unique NameFC920180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:8..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI12_ORYSJ (Chitinase 12 OS=Oryza sativa subsp. japonica GN=Cht12 PE=2 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 8.336e-52
Identity = 99/187 (52.94%), Postives = 118/187 (63.10%), Query Frame = 2
Query:  101 AGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNET-MRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNRE-VGAASSDYCDPN--YPCRG--KYYGRGPIQLTWKLHY 634
            A  CGS   G VCP   CCS+FGWCG T D+C  GCQS C+   CG   P   +   G  +  I+SR +F+ +L +RND  CPA  FYTYDAF+ AA AFP F  +G +    KRE+AAF AQT HETTGGW  AP G YAWGYCF  E  GAA  DYC  +  +PC    KYYGRGPIQL++  +Y
Sbjct:   21 AEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAGCQSQCSAAGCGGGGPTPPSGSGGSGVASIVSRSLFDQMLLHRNDAACPASNFYTYDAFVAAASAFPGFAAAGGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWGYCFKEENGGAAGPDYCQQSAQWPCAAGKKYYGRGPIQLSYNFNY 207          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_ORYSJ (Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht2 PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.089e-51
Identity = 102/186 (54.84%), Postives = 123/186 (66.13%), Query Frame = 2
Query:  101 AGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECD-PDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            A  CG+   G  CP   CCSR+GWCG T D C DGCQS C+   CG    P   +  DG  +G I+ R++FE LL +RND  CPAR FYTY+AF+ AA AFPAFG +GN   RKRE+AAF  QT HETTGGWP AP G ++WGYCF +E     SDYC P+  +PC    KYYGRGPIQL++  +Y
Sbjct:   32 AEQCGAQAGGARCPNCLCCSRWGWCGTTSDFCGDGCQSQCSG--CGPTPTPTPPSPSDG--VGSIVPRDLFERLLLHRNDGACPARGFYTYEAFLAAAAAFPAFGGTGNTETRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQEQN-PPSDYCQPSPEWPCAPGRKYYGRGPIQLSFNFNY 212          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.168e-51
Identity = 99/182 (54.40%), Postives = 118/182 (64.84%), Query Frame = 2
Query:  104 GNCGSGVVCPGGECCSRFGWCGLTIDHCCD-GCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWKLHY 634
            G    G +CP G CCS FGWCG T  +C   GCQS C     G   P     G  G+L  IISR  F+D+L++RND  CPAR FYTYDAFI AAK+FP FG +G+   RK+EIAAFF QT HETTGGW  AP G Y+WGYCF +E    SS+YC P+  +PC     YYGRGP+QL+W  +Y
Sbjct:   24 GRQAGGALCPNGLCCSEFGWCGDTEAYCKQPGCQSQC-----GGTPP-----GPTGDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQN-PSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNY 194          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.137e-51
Identity = 100/190 (52.63%), Postives = 123/190 (64.74%), Query Frame = 2
Query:  101 AGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELG-----KIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            A  CGS   G +CP   CCS +GWCG T D+C DGCQS C+   CG      G  G GG  G      ++S+E+FE LL +RND  CPAR FYTYDA + AA AFP F  +G++  RKRE+AAF  QT HETTGGW  AP G Y+WGYCF  E+GA +S YC P+  +PC    KY+GRGPIQL++  +Y
Sbjct:   23 AEQCGSQAGGALCPNCLCCSSYGWCGSTSDYCGDGCQSQCDG--CGGGGGGGGGGGGGGGGGGGAVEAVVSKELFEQLLLHRNDAACPARGFYTYDALVTAAAAFPDFAATGDDEARKREVAAFLGQTSHETTGGWATAPDGPYSWGYCFKEEIGATAS-YCVPSAEWPCAPDKKYFGRGPIQLSYNYNY 209          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI1_ORYSJ (Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht1 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 7.056e-51
Identity = 93/186 (50.00%), Postives = 118/186 (63.44%), Query Frame = 2
Query:   92 GGSAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNRE-VGAASSDYC--DPNYPCRG--KYYGRGPIQLTWKLHY 634
            G   G+   G +CP   CCS++GWCG T  +C  GCQS C+   CG   P   + G G  +  I+SR +F+ +L +RND  CPA+ FYTYDAF+ AA AFP+F  +G+   RKRE+AAF AQT HETTGGW  AP G Y+WGYCF  E  G   SDYC     +PC    KYYGRGPIQ+++  +Y
Sbjct:   20 GEQCGSQAGGALCPNCLCCSQYGWCGSTSAYCGSGCQSQCSGS-CGGGGPTPPSGGGGSGVASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPSFATTGDAATRKREVAAFLAQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQISYNYNY 204          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.572e-50
Identity = 101/187 (54.01%), Postives = 122/187 (65.24%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CGS   G  C  G CCS+FGWCG T D+C  G CQS C         P   T   GG+LG IIS  MF+ +L++RND  C  + FY+Y+AFI AA++FP FG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC+ RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   22 SAEQCGSQAGGARCASGLCCSKFGWCGNTNDYCGPGNCQSQC---------PGGPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQG-SPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNY 198          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIA_SECCE (Basic endochitinase A OS=Secale cereale GN=rsca PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.502e-50
Identity = 103/189 (54.50%), Postives = 124/189 (65.61%), Query Frame = 2
Query:  101 AGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCG----ECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR-GK-YYGRGPIQLTWKLHY 634
            A  CGS   G  CP   CCSRFGWCG T D+C DGCQS C    CG       P    +G GG +  I+SR +F+ +L +RND  C A+ FYTYDAF+ AA AFP FG +G+   RKRE+AAF AQT HETTGGW  AP G +AWGYCF +E G A+S+YC P+  +PC  GK YYGRGPIQL+   +Y
Sbjct:   19 AEQCGSQAGGATCPNCLCCSRFGWCGSTSDYCGDGCQSQC--AGCGGGGTPVTPTPTPSGGGG-VSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAAGAFPGFGTTGSTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERG-ATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNY 203          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIT_SOLTU (Endochitinase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.974e-50
Identity = 100/187 (53.48%), Postives = 121/187 (64.71%), Query Frame = 2
Query:  101 AGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTA-GDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            A NCGS   G  C  G+CCS+FGWCG T D+C  G CQS C         P  G   G GG+LG  IS  MF+ +L++RN+  C  + FY+Y+AFI AA++FP FG SG+   RKREIAAFFAQT HETTGGW  AP G YAWGYCF RE G    DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   26 AQNCGSQGGGKACASGQCCSKFGWCGNTNDYCGSGNCQSQC---------PGGGPGPGPGGDLGSAISNSMFDQMLKHRNENSCQGKNFYSYNAFINAARSFPGFGTSGDINARKREIAAFFAQTSHETTGGWASAPDGPYAWGYCFLRERG-NPGDYCPPSSQWPCAPGRKYFGRGPIQISHNYNY 202          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIX_PEA (Endochitinase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.738e-49
Identity = 96/187 (51.34%), Postives = 119/187 (63.64%), Query Frame = 2
Query:   92 GGSAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDP-NYPCR--GKYYGRGPIQLTWKLHY 634
            G  A  CGS   G VCP G CCS+FG+CG T  +C DGCQS C         P   T G  G++G+++   +F+ +L+YRND RC    FYTYDAFI AA++F  FG +G++  +K+E+AAF AQT HETTGGWP AP G YAWGYCF  E       YC P ++PC    KYYGRGPIQLT   +Y
Sbjct:   20 GSKAEQCGSQAGGAVCPNGLCCSKFGFCGSTDPYCGDGCQSQCKSSPTPTI-PTPSTGG--GDVGRLVPSSLFDQMLKYRNDGRCAGHGFYTYDAFIAAARSFNGFGTTGDDNTKKKELAAFLAQTSHETTGGWPTAPDGPYAWGYCFVSEQN-TQEVYCSPKDWPCAPGKKYYGRGPIQLTHNYNY 202          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI3_ORYSJ (Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht3 PE=2 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 1.738e-49
Identity = 91/187 (48.66%), Postives = 118/187 (63.10%), Query Frame = 2
Query:   92 GGSAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECD--PDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCD--PNYPCRG--KYYGRGPIQLTWKLHY 634
            G   G+   G +CP   CCS++GWCG T D+C  GCQS C+    G C   P   ++G G  +  IIS  +F+ +L +RND+ C A+ FYTYDAF+ AA A+P F  +G+    KRE+AAF AQT HETTGGWP AP G Y+WGYCF  E    +  YC+  P +PC    KYYGRGPIQ+T+  +Y
Sbjct:   18 GEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGAGCQSQCS----GGCGGGPTPPSSGGGSGVASIISPSLFDQMLLHRNDQACAAKGFYTYDAFVAAANAYPDFATTGDADTCKREVAAFLAQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEPKPEWPCAAGKKYYGRGPIQITYNYNY 200          
The following BLAST results are available for this feature:
BLAST of FC920180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI12_ORYSJ8.336e-5252.94Chitinase 12 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHI2_ORYSJ1.089e-5154.84Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI2_BRANA3.168e-5154.40Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHI9_ORYSJ4.137e-5152.63Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI1_ORYSJ7.056e-5150.00Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI2_TOBAC1.572e-5054.01Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHIA_SECCE3.502e-5054.50Basic endochitinase A OS=Secale cereale GN=rsca PE... [more]
CHIT_SOLTU5.974e-5053.48Endochitinase OS=Solanum tuberosum PE=2 SV=1[more]
CHIX_PEA1.738e-4951.34Endochitinase OS=Pisum sativum PE=2 SV=1[more]
CHI3_ORYSJ1.738e-4948.66Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A08EF RVDevelop1 Citrus clementina cDNA clone C32005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920180 ID=FC920180|Name=FC920180|organism=Citrus clementina|type=EST|length=642bp
AGCAGAGGATAATTGATCTCATAACTGTTGCTTTCAAATGAGGCTTATTG
CGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTCA
GCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTAG
TCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGCC
AAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGGG
ACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTT
TGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGCT
TCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTT
GGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTT
TGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTG
GCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTCG
TCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCG
AGGTCCAATTCAACTCACTTGGAAATTACATTACTTACGGTG
back to top