FC920180

Overview
NameFC920180
Unique NameFC920180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:8..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSI (Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.130e-39
Identity = 88/188 (46.81%), Postives = 114/188 (60.64%), Query Frame = 2
Query:  104 GNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDG-----TAGDGGELG--KIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR-GK-YYGRGPIQLTWKLHY 634
            G    G  CP   CCSR+GWCGLT D+C  GCQS C   V  +   DD      TA  GG  G   +++ + FE +L +R+D  CPAR FY Y AF+ AA AFPAF  +G+   RKRE+AAF AQT H T+       GG Y+WGYC+ +EV  A+SD+C PN  +PC  GK Y+ RGP+Q+ +  +Y
Sbjct:   36 GRQAGGARCPNRLCCSRWGWCGLTDDYCKGGCQSQCR--VSRDGGDDDVAAVLLTAPGGGRAGVASVVTSDQFERMLPHRDDAACPARGFYAYRAFVAAAGAFPAFAATGDADTRKREVAAFLAQTSHATS-------GGPYSWGYCY-KEVKGATSDFCVPNARWPCAPGKAYHARGPMQIAYNYNY 213          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI8_POPTR (Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.400e-37
Identity = 77/185 (41.62%), Postives = 98/185 (52.97%), Query Frame = 2
Query:   92 GGSAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDP----NYPCRGKYYGRGPIQLTWKLHY 634
            G  AGN      CP   CCS  G+CGLT+ +CC GC S C                         +  MFE +L  RN+  CP + FYTYDA+  A + +P FG +G++  RKRE+AAFFAQT  ET+G         + WGYC   E+   +SDYCDP    +YPC   YYGRGP+QL W  +Y
Sbjct:   27 GSQAGNA----TCPNDLCCSSGGYCGLTVAYCCAGCVSQCRNC--------------------FFTESMFEQMLPNRNNDSCPGKGFYTYDAYFVATEFYPGFGMTGDDDTRKRELAAFFAQTSQETSGRSIIGEDAPFTWGYCLVNELN-PNSDYCDPKTKSSYPCVADYYGRGPLQLRWNYNY 186          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_HORVU (26 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.910e-36
Identity = 72/127 (56.69%), Postives = 90/127 (70.87%), Query Frame = 2
Query:  266 GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            G +  I+SR  F+ +L +RND  C A+ FYTYDAF+ AA AFP FG +G+   +KRE+AAF AQT HETTGGW  AP G +AWGYCF +E G ASSDYC P+  +PC    +YYGRGPIQL+   +Y
Sbjct:   23 GSVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFPGFGTTGSADAQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERG-ASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNY 148          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIC_SECCE (Basic endochitinase C OS=Secale cereale GN=rscc PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.182e-35
Identity = 71/127 (55.91%), Postives = 89/127 (70.08%), Query Frame = 2
Query:  266 GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            G +  IIS   F+ +L +RND  C A+ FYTYDAF+ AA AFP FG +G+   RKR++AAF AQT HETTGGW  AP G +AWGYCF +E GAA +DYC P+  +PC    +YYGRGPIQL+   +Y
Sbjct:   23 GSVSSIISHAQFDRMLLHRNDGACQAKGFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGAA-ADYCTPSAQWPCAPGKRYYGRGPIQLSHNYNY 148          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHID_SOLLC (Basic endochitinase (Fragment) OS=Solanum lycopersicum GN=CHI14 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.024e-33
Identity = 66/125 (52.80%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  272 LGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR--GKYYGRGPIQLTWKLHY 634
            +  +IS+ +FE +L +RND+ C A+ FYTY+AFI A K F AFG +G+   R +EIAAF AQT HETTGGW  AP G Y+WGYC+NRE G +  DYC     +PC    KY+GRGPIQ+++  +Y
Sbjct:    5 ISSLISKNLFERILVHRNDRACGAKGFYTYEAFITATKTFAAFGTTGDTNTRNKEIAAFLAQTSHETTGGWATAPDGPYSWGYCYNREQG-SPGDYCASSQQWPCAPGKKYFGRGPIQISYNYNY 128          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI11_ORYSJ (Chitinase 11 OS=Oryza sativa subsp. japonica GN=Cht11 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.788e-31
Identity = 67/129 (51.94%), Postives = 81/129 (62.79%), Query Frame = 2
Query:  248 GTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            G +G    +G II+R MFE +L +R D+ C    FYTYDAFI+AA  FP FG +GN+  R+RE+AAFF QT HETTGGW  AP G +AWGYC   E+            P    YYGRGPIQLT K +Y
Sbjct:   19 GASGQQAGVGSIITRAMFESMLSHRGDQGCQG-AFYTYDAFIKAAGDFPRFGTTGNDETRRRELAAFFGQTSHETTGGWATAPDGPFAWGYCRVNEI-----------TPSDPPYYGRGPIQLTHKYNY 135          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 5.258e-30
Identity = 65/141 (46.10%), Postives = 84/141 (59.57%), Query Frame = 2
Query:  248 GTAGDGG------ELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCD------PNYPCRGKYYGRGPIQLTWKLHY 634
            G  G GG       +  I+S +++  L  +++D  CPAR FYTY +F+ AA  FP F  +G    RKRE+AAF AQ  HETTGGW  AP G YAWG C+  E+   SS YCD      P YP +  Y+GRGPIQ++W  +Y
Sbjct:   35 GGGGGGGYSPSPSPVSSIVSEQLYASLFLHKDDAACPARGFYTYASFVRAATRFPRFAATGCADARKREVAAFLAQISHETTGGWATAPDGPYAWGLCYKEEINPQSS-YCDATDKQWPCYPGK-SYHGRGPIQISWNFNY 173          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIB_SOLLC (Acidic 27 kDa endochitinase OS=Solanum lycopersicum GN=CHI17 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.885e-28
Identity = 63/122 (51.64%), Postives = 82/122 (67.21%), Query Frame = 2
Query:  269 ELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            ++G I++ ++F ++L+ RND RCPA+ FYTYDAFI AA +FP FG +G++T RK+EIAAFF QT HETTGG   A  G +A GYCF RE     S            +YGRGPIQLT + +Y
Sbjct:   18 DVGTIVTSDLFNEMLKNRNDDRCPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGGSLSA-DGPFAGGYCFVREGNQMGSG-----------FYGRGPIQLTGQSNY 127          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIA_SOLCI (Acidic endochitinase pcht28 OS=Solanum chilense PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.885e-28
Identity = 61/122 (50.00%), Postives = 80/122 (65.57%), Query Frame = 2
Query:  275 GKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHYLR 640
            G I++RE+FE +L +RN+  CPA+ FYTYDAFI AA +FP FG +G++T RK+EIAAFF QT HET GG      G +  GYCF R++  +             +YYGRGPIQLT + +Y R
Sbjct:   28 GSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETKGG----SAGTFTGGYCFVRQIDQSD------------RYYGRGPIQLTHQSNYER 133          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIA_SOLLC (Acidic 26 kDa endochitinase OS=Solanum lycopersicum GN=CHI3 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.427e-28
Identity = 60/122 (49.18%), Postives = 80/122 (65.57%), Query Frame = 2
Query:  275 GKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHYLR 640
            G I++RE+FE +L +RN+  CPA+ FYTYDAFI AA +FP FG +G++T RK+EIAAFF QT HET GG      G +  GYCF +++  +             +YYGRGPIQLT + +Y R
Sbjct:   28 GSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTAGDDTARKKEIAAFFGQTSHETNGG----SAGTFTGGYCFVKQIEQSD------------RYYGRGPIQLTHQSNYER 133          
The following BLAST results are available for this feature:
BLAST of FC920180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI7_ORYSI2.130e-3946.81Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 ... [more]
CHI8_POPTR3.400e-3741.62Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 ... [more]
CHI2_HORVU4.910e-3656.6926 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=... [more]
CHIC_SECCE3.182e-3555.91Basic endochitinase C OS=Secale cereale GN=rscc PE... [more]
CHID_SOLLC1.024e-3352.80Basic endochitinase (Fragment) OS=Solanum lycopers... [more]
CHI11_ORYSJ2.788e-3151.94Chitinase 11 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHI10_ORYSJ5.258e-3046.10Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHIB_SOLLC2.885e-2851.64Acidic 27 kDa endochitinase OS=Solanum lycopersicu... [more]
CHIA_SOLCI2.885e-2850.00Acidic endochitinase pcht28 OS=Solanum chilense PE... [more]
CHIA_SOLLC6.427e-2849.18Acidic 26 kDa endochitinase OS=Solanum lycopersicu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A08EF RVDevelop1 Citrus clementina cDNA clone C32005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920180 ID=FC920180|Name=FC920180|organism=Citrus clementina|type=EST|length=642bp
AGCAGAGGATAATTGATCTCATAACTGTTGCTTTCAAATGAGGCTTATTG
CGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTCA
GCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTAG
TCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGCC
AAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGGG
ACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTT
TGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGCT
TCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTT
GGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTT
TGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTG
GCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTCG
TCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCG
AGGTCCAATTCAACTCACTTGGAAATTACATTACTTACGGTG
back to top