FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS6_IPOBA (Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DII PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 7.221e-99
Identity = 155/182 (85.16%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E+R AQRA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 58.5362 bits (140), Expect = 7.221e-99
Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVL+VCSEIT VTFRGP++THLDSLVG
Sbjct:  181 NKGARVLIVCSEITVVTFRGPSETHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_MATIN (Chalcone synthase OS=Matthiola incana GN=CHS PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 7.221e-99
Identity = 154/180 (85.56%), Postives = 168/180 (93.33%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ++ EIR AQRADGPA +L IGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKF+RMCDKSMI+KR+M+LTE+ LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA +AIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    7 SLDEIRKAQRADGPAGILGIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRKRHMHLTEDFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 186          

HSP 2 Score: 60.8474 bits (146), Expect = 7.221e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_HYDMC (Chalcone synthase OS=Hydrangea macrophylla GN=CHS PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 9.421e-99
Identity = 151/182 (82.97%), Postives = 169/182 (92.86%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E+R AQRA+GPAT+LAIGTATP + V+Q+ YPD+YFR+T SEH  ELK KF+RMCD S IKKRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVE+PKLGKEAAT+AIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPPNYVDQSTYPDFYFRVTNSEHKKELKAKFQRMCDNSQIKKRYMHLTEEILKENPNICAYMAPSLDARQDMVVVEIPKLGKEAATRAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.003 bits (149), Expect = 9.421e-99
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS6_PEA (Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.229e-98
Identity = 153/182 (84.07%), Postives = 169/182 (92.86%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTATPA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTATPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.229e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS2_MAIZE (Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.603e-98
Identity = 155/180 (86.11%), Postives = 168/180 (93.33%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA GPATVLAIGTATPA+ V QADYPDYYFRITKSEH+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYMAPSLDARQD+VVVEVPKLGK AA KAIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLRPSV R MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLAENPSMCAYMAPSLDARQDVVVVEVPKLGKAAAQKAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 57.7658 bits (138), Expect = 1.603e-98
Identity = 26/31 (83.87%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSLVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_PERFR (Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.603e-98
Identity = 156/180 (86.67%), Postives = 170/180 (94.44%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            M TV++IR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH T+LKEKFKRMC+KSMI+KRYM+LTEE LKENPNM AYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLR+AKDLAEN
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN 180          

HSP 2 Score: 56.6102 bits (135), Expect = 1.603e-98
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  183 GARVLVVCSEITAVTFRGPSESHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_TRISU (Chalcone synthase 3 OS=Trifolium subterraneum GN=CHS3 PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.603e-98
Identity = 153/182 (84.07%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.603e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS2_MEDSA (Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=1 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.603e-98
Identity = 153/182 (84.07%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.603e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_PINST (Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.092e-98
Identity = 153/182 (84.07%), Postives = 170/182 (93.41%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            MA ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRYMYLTEEIL ENP++CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITH+IFCTTSGVDMPGADYQ+TKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFRRMCDKSGIKKRYMYLTEEILNENPSVCAYMAPSLDARQDMVVVEVPRLGKEAAAKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQMTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNR 187          

HSP 2 Score: 60.077 bits (144), Expect = 2.092e-98
Identity = 27/31 (87.10%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDS+VG
Sbjct:  186 NRGARVLVVCSEITAVTFRGPSDTHLDSMVG 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS4_TRISU (Chalcone synthase 4 (Fragment) OS=Trifolium subterraneum GN=CHS4 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.095e-98
Identity = 153/182 (84.07%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 2.095e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS6_IPOBA7.221e-9985.16Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DI... [more]
CHSY_MATIN7.221e-9985.56Chalcone synthase OS=Matthiola incana GN=CHS PE=2 ... [more]
CHSY_HYDMC9.421e-9982.97Chalcone synthase OS=Hydrangea macrophylla GN=CHS ... [more]
CHS6_PEA1.229e-9884.07Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 ... [more]
CHS2_MAIZE1.603e-9886.11Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1[more]
CHSY_PERFR1.603e-9886.67Chalcone synthase OS=Perilla frutescens GN=CHS PE=... [more]
CHS3_TRISU1.603e-9884.07Chalcone synthase 3 OS=Trifolium subterraneum GN=C... [more]
CHS2_MEDSA1.603e-9884.07Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=... [more]
CHSY_PINST2.092e-9884.07Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=... [more]
CHS4_TRISU2.095e-9884.07Chalcone synthase 4 (Fragment) OS=Trifolium subter... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top