FC920405

Overview
NameFC920405
Unique NameFC920405
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14135 contig Ccv1_Contig14135:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METMJ (50S ribosomal protein L18P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.084e-13
Identity = 54/162 (33.33%), Postives = 73/162 (45.06%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSE 620
            RY V ++RR EGKTDY  R+ L++       TP  R VVR TN+ I  Q++   + GD  L +AY+ EL  YG E    +  AAY TG+L A                V+A    Y            A+LD+GL +   G RVF            +P+ E
Sbjct:    6 RYFVPFRRRHEGKTDYYKRMSLLSS-----GTP--RMVVRKTNRQIIVQLVVPEVEGDSTLVAAYSAELAGYGYEGSTASTPAAYLTGMLFA----------------VKALNAGYG----------EAILDIGLARAKPGARVFAALKGAVDAGLDVPYGE 134          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METPE (50S ribosomal protein L18P OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.415e-13
Identity = 56/163 (34.36%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEK 623
            RY V ++RRREGKTDY  R +LI  ++        R VVR TN+ I  Q+I A + GD  L +A + EL  YG +   +N  AAY TG+L A                V+A   D+            A+LD+GL + T G +VF            +PH E+
Sbjct:    6 RYFVPFRRRREGKTDYYKRGKLIVAEQP-------RMVVRKTNRHIIVQMIVAEMEGDKTLVTANSAELLDYGYKGSTSNTPAAYLTGMLFA----------------VKALNADHPA----------AILDIGLNRATYGAKVFAALKGAVEAGLDVPHGEE 135          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METM5 (50S ribosomal protein L18P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.849e-13
Identity = 54/166 (32.53%), Postives = 79/166 (47.59%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFA 632
            +++V ++RRREGKTD+R R+ L+   K        R V R +  ++TAQ++S    GD+VL SA+  EL + G +    N  AAY TGLLL ++ +K        EG  E                  A+LD GL + T G  +F            IPH ++  A
Sbjct:    6 KFRVPFRRRREGKTDFRQRLGLLLSGKP-------RLVARKSLNNVTAQLMSYDEKGDVVLVSAHTKELVKMGYKGHCGNLPAAYLTGLLLGKKAVK--------EGAEE------------------AILDKGLHRATKGAAIFAVLKGALDAGMDIPHGDEIIA 138          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METBU (50S ribosomal protein L18P OS=Methanococcoides burtonii (strain DSM 6242) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.414e-13
Identity = 50/165 (30.30%), Postives = 77/165 (46.67%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRF 629
            RY+V ++RRREG+TDY  R+RL+   ++       R VVR + + +  Q+++    GD+ L+SA + EL +YG E    N  AAY TGLL   + L        YE  V                     LD+G+  ++ G+RV+            +PH+   F
Sbjct:    6 RYKVAFRRRREGRTDYHQRLRLLLSRED-------RVVVRKSARHMQIQLVAPDANGDVTLSSAISKELAKYGYEGSTGNTTAAYLTGLLFGYKTLA-----EGYESGV---------------------LDIGIQASSAGSRVYAALKGVVDSGLDVPHNSSVF 137          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_NATPD (50S ribosomal protein L18P OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.153e-13
Identity = 53/170 (31.18%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSK 644
            RY V  +RRRE +T+Y  R+RL+   K        R V R +N    AQ++     GD  +ASA + +L  +G E    N  AAY TGLL  +R ++               G D             A+LD+GL   T GN+VF            +PH+E  FA + +
Sbjct:    6 RYTVPMRRRREARTNYHQRLRLLKSGKP-------RLVARKSNNQTKAQLVVTGPQGDETVASATSADLEAFGWEAPTGNLPAAYLTGLLAGKRAIE--------------AGLD------------EAVLDIGLNTATPGNKVFAVQEGVIDAGLEVPHNEDVFADWQR 142          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_AERPE (50S ribosomal protein L18P OS=Aeropyrum pernix GN=rpl18p PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.118e-13
Identity = 56/168 (33.33%), Postives = 76/168 (45.24%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHEL-PRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAG 635
            RY+V  +RRREGKT+Y  R RL+   K        R  VR +N+ +  Q + A I GD V+A+A++ EL  ++G +    N  AAY TG L   R L+                          +    A+LDVGL K   G+RVF            IPHSE+   G
Sbjct:    6 RYRVPLRRRREGKTNYYRRFRLVKSGKP-------RMAVRISNEYLWVQFLEARIEGDRVIAAAHSRELIKKFGWKGDGNNTCAAYLTGYLAGLRALE--------------------------KGVREAVLDVGLHKPVKGSRVFAALKGALDAGVEIPHSEEILPG 140          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_RABIT (60S ribosomal protein L5 (Fragments) OS=Oryctolagus cuniculus GN=RPL5 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.379e-13
Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKY 239
            K  K+KAYFKRYQVK++RRREGKTDY AR RL+ QDKNKYNTP +
Sbjct:    4 KVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPAH 48          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METMP (50S ribosomal protein L18P OS=Methanococcus maripaludis GN=rpl18p PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.379e-13
Identity = 53/166 (31.93%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFA 632
            +++V ++RRREGKTD+R R+ L+   K        R V R +  ++TAQ+++    GD+VL SA++ EL + G +    N  AAY TGLLL  + +K                ED             A+LD GL + T G  +F            IPH +K  A
Sbjct:    6 KFRVPFRRRREGKTDFRQRLGLLLSGKP-------RLVARKSLNNVTAQLMAYDEKGDVVLVSAHSKELVKMGYKGHCGNLPAAYLTGLLLGAKAVK----------------EDVK----------EAVLDKGLHRATKGAAIFAVLKGALDAGMDIPHGDKIIA 138          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_HALWD (50S ribosomal protein L18P OS=Haloquadratum walsbyi (strain DSM 16790) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.025e-13
Identity = 53/171 (30.99%), Postives = 75/171 (43.86%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKD 647
            RY+V  +RRRE +TDY  R+RL+   K        R V R +N+ + AQ+I+    GD    +A +  L  YG E    N  +AY TG L   R ++               G D             A+LD+GL   T GN+VF            IPH+E   A +S++
Sbjct:    6 RYKVPMRRRREVRTDYHQRLRLLKSGKP-------RLVARVSNRHVRAQLITPGPDGDETHVAASSEHLSEYGWEAPTGNLPSAYLTGYLAGMRAIE--------------AGLD------------EAVLDIGLNTATPGNKVFVVQEGAIDAGVSIPHNESVLADWSRN 143          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METM7 (50S ribosomal protein L18P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.198e-12
Identity = 52/166 (31.33%), Postives = 79/166 (47.59%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFA 632
            +++V ++RRREGKTD+R R+ L+   K        R V R +  ++ AQ+++    GD+VL SA++ EL + G +    N  AAY TGLLL ++ +K        EG  E                  A+LD GL + T G  +F            IPH ++  A
Sbjct:    6 KFRVPFRRRREGKTDFRQRLGLLLSGKP-------RLVARKSLNNVIAQLMAYDEKGDVVLVSAHSRELVKMGYKGHCGNLPAAYLTGLLLGKKAVK--------EGAEE------------------AILDKGLHRATKGAAIFAVLKGALDAGMDIPHGDEIIA 138          
The following BLAST results are available for this feature:
BLAST of FC920405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
RL18_METMJ1.084e-1333.3350S ribosomal protein L18P OS=Methanoculleus maris... [more]
RL18_METPE1.415e-1334.3650S ribosomal protein L18P OS=Methanosphaerula pal... [more]
RL18_METM51.849e-1332.5350S ribosomal protein L18P OS=Methanococcus maripa... [more]
RL18_METBU2.414e-1330.3050S ribosomal protein L18P OS=Methanococcoides bur... [more]
RL18_NATPD3.153e-1331.1850S ribosomal protein L18P OS=Natronomonas pharaon... [more]
RL18_AERPE4.118e-1333.3350S ribosomal protein L18P OS=Aeropyrum pernix GN=... [more]
RL5_RABIT5.379e-1375.5660S ribosomal protein L5 (Fragments) OS=Oryctolagu... [more]
RL18_METMP5.379e-1331.9350S ribosomal protein L18P OS=Methanococcus maripa... [more]
RL18_HALWD7.025e-1330.9950S ribosomal protein L18P OS=Haloquadratum walsby... [more]
RL18_METM71.198e-1231.3350S ribosomal protein L18P OS=Methanococcus maripa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H05EF RVDevelop1 Citrus clementina cDNA clone C32007H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920405 ID=FC920405|Name=FC920405|organism=Citrus clementina|type=EST|length=708bp
GGAGCGTGTTAGGGTTTAAGTACATTGGATTTAGCTCGCGGCTCCTTCAC
AACTTCTCGAACTCTGCTGCTTCTACACTTTGAGCTTCAGCAATGGCCTT
TGCCAAAGCTCAAAAGTCAAAAGCTTACTTTAAGCGATATCAAGTTAAGT
ACAAGAGAAGGCGAGAGGGAAAGACTGACTATCGGGCTAGGATTCGCCTG
ATCAACCAAGATAAAAACAAGTACAACACGCCAAAGTATCGGTTTGTTGT
GCGATTCACCAACAAAGATATCACTGCACAAATTATATCTGCCAGCATAG
CCGGGGATATAGTCCTTGCATCTGCTTATGCCCATGAGCTTCCCCGTTAT
GGTCTTGAGGTGGGCCTCACTAATTATGCAGCAGCTTATTGCACTGGACT
CCTCTTGGCCCGCCGAGTCCTGAAAATGCTTGAGATGGATGCTGAGTATG
AGGGGAACGTTGAGGCAACAGGAGAGGACTATTCAGTTGAGCCAACTGAG
AACAGGAGGCCTTTCCGTGCCCTGCTTGATGTTGGTCTTGTGAAAACAAC
TACTGGTAACCGTGTCTTTGGCGCTCTTAAGGGTGCATTGGATGGTGGAC
TTGATATCCCTCACAGTGAGAAGAGATTTGCTGGATTCAGTAAGGATAGT
AAGCAACTTGACGCTGAAGTTCACCGTAAATACATCTATTGTGGTCGTGT
CGCTGCCT
back to top