FC920405

Overview
NameFC920405
Unique NameFC920405
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14135 contig Ccv1_Contig14135:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METBF (50S ribosomal protein L18P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.947e-12
Identity = 50/165 (30.30%), Postives = 79/165 (47.88%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRF 629
            RY+V ++RRREG+T+Y  R++L+   ++       R VVR + +++  Q+I+ +  GDI  +SA + EL +YG      N  AAY TGLL   + LK       YEG +                     LD+GL  ++ G+RV+            +P S + F
Sbjct:    6 RYKVPFRRRREGRTNYHLRLKLLISKQD-------RVVVRKSARNVQIQLIAPTPEGDITYSSAVSSELAKYGYTGVTGNTTAAYLTGLLFGLKSLK-----KGYEGGI---------------------LDIGLQASSAGSRVYAALKGIVDSGFEVPCSPEVF 137          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_DESK1 (50S ribosomal protein L18P OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.947e-12
Identity = 49/138 (35.51%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHEL-PRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVK 545
            RY+V  +RRREGKT+Y  R R+I            RF+VR T   I  Q+ +A   GD+++A+A+++EL  R+G + G  N +AAY TGLL A R L+               G +Y+V      RP +  L    +K
Sbjct:    6 RYKVPRRRRREGKTNYYKRYRMIVSGHP-------RFIVRKTLNYIWVQVATARPEGDVIIAAAHSNELRKRFGWKAGTCNTSAAYLTGLLAALRALE--------------KGVEYAVPDIGLHRPVKGALVFAAIK 122          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_THEPD (50S ribosomal protein L18P OS=Thermofilum pendens (strain Hrk 5) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.767e-12
Identity = 52/138 (37.68%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRAL---LDVGL 539
            RY+V  KRRREGKT+Y  R +LI   K        R VVR  ++    QI  A+  GD+V+ASA+++EL +YG +    N  A Y  G L A++ LK        +G  EA  +     P +  R F A+   LD GL
Sbjct:    6 RYRVPLKRRREGKTNYYKRRKLIISGKP-------RLVVRVLSRTAIVQIAKATPKGDVVIASAHSNELKKYGWKGYRRNTPALYLLGFLAAKKALK--------QGVTEAIVDIGLHRPVKASRVFAAVKGALDAGL 128          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_NANEQ (50S ribosomal protein L18P OS=Nanoarchaeum equitans GN=rpl18p PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.767e-12
Identity = 51/166 (30.72%), Postives = 75/166 (45.18%), Query Frame = 3
Query:  123 AYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSE 620
            A+  RY+V ++RRREGKT YR R++L+   K        R VVR  N +I AQ++     GD V+ + +++ L +YG +    N  +AY  GL+     LK                          R    A+LD+G  K+T GN ++            IPHSE
Sbjct:    2 AHGPRYRVPFRRRREGKTVYRKRLKLLLSGKP-------RLVVRRFNSNILAQLVEYDPKGDRVIFTIHSNVLKKYGWKGHRGNLPSAYLVGLIAGYEALK--------------------------RGYKEAVLDIGRYKSTKGNALYAVLKGALDAGLNIPHSE 134          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_HALLT (50S ribosomal protein L18P OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.767e-12
Identity = 51/170 (30.00%), Postives = 74/170 (43.53%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSK 644
            RY+V  +RRRE +TDY  R+RL+   K        R V R +N  + AQ+++    GD   A+A + EL  YG +    N  +AY TG L   R      +DA  +                      A+LD+GL   T GN+ F            IPH++   A +S+
Sbjct:    6 RYKVPMRRRREVRTDYHQRLRLLKSGKP-------RLVARVSNAHVRAQLVTPGSDGDETHAAASSEELGEYGWDAPTGNLPSAYLTGYLAGARA-----VDAGLD---------------------EAVLDIGLNTATPGNKTFAVQEGAIDAGLEIPHNDDVLADWSR 142          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METMA (50S ribosomal protein L18P OS=Methanosarcina mazei GN=rpl18p PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.014e-11
Identity = 51/165 (30.91%), Postives = 79/165 (47.88%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRF 629
            RY+V ++RRREG+T+Y  R++L+   ++       R VVR + +++  Q+++ +  GDI  +SA + EL +YG      N  AAY TGLL     LK L+    YEG +                     LD+GL  ++ G+RV+            IP S   F
Sbjct:    6 RYKVPFRRRREGRTNYHLRLKLLLSGQD-------RVVVRKSARNVQIQLLAPTPEGDITYSSAVSSELAKYGYTGATGNTTAAYLTGLLFG---LKSLQKG--YEGGI---------------------LDIGLQASSAGSRVYAALKGIVDSGFEIPCSSDVF 137          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METVS (50S ribosomal protein L18P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.260e-11
Identity = 56/183 (30.60%), Postives = 86/183 (46.99%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKY 683
            +++V ++RRREGKTD+R R+ L+   K        R V R +  +I AQ+++    GDIVL SA++ EL + G +    N  AAY TGLLL ++ ++        EG  E                  A+LD GL + T G  +F            IP  E+  A    D ++L+    ++Y
Sbjct:    6 KHRVPFRRRREGKTDFRQRLGLLLSGKP-------RLVARKSLNNIIAQLMAYDEKGDIVLVSAHSRELVKMGYKGHCGNLPAAYLTGLLLGKKAVE--------EGLEE------------------AILDKGLHRATKGAAIFAVLKGALDAGMDIPCGEEIIA----DEERLNGTHIKQY 151          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METVA (50S ribosomal protein L18P OS=Methanococcus vannielii GN=rpl18p PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.260e-11
Identity = 56/183 (30.60%), Postives = 86/183 (46.99%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKY 683
            +++V ++RRREGKTD+R R+ L+   K        R V R +  +I AQ+++    GDIVL SA++ EL + G +    N  AAY TGLLL ++ ++        EG  E                  A+LD GL + T G  +F            IP  E+  A    D ++L+    ++Y
Sbjct:    8 KHRVPFRRRREGKTDFRQRLGLLLSGKP-------RLVARKSLNNIIAQLMAYDEKGDIVLVSAHSRELVKMGYKGHCGNLPAAYLTGLLLGKKAVE--------EGLEE------------------AILDKGLHRATKGAAIFAVLKGALDAGMDIPCGEEIIA----DEERLNGTHIKQY 153          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METST (50S ribosomal protein L18P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.034e-11
Identity = 44/134 (32.84%), Postives = 66/134 (49.25%), Query Frame = 3
Query:  138 YQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGL 539
            Y+V++KRRREGKT+Y  R +L++ DK        R VVR T+     Q++     GD  L SA +  L  +G      N +AAY TG L  ++ L     +  Y+  +   G   S++ T+     +  LD GL
Sbjct:    7 YKVQFKRRREGKTNYNKRYKLVDLDKT-------RMVVRITSNHTITQLVKIGENGDETLVSATSKNLKEFGWLGNGKNTSAAYLTGYLFGKKAL-----NEGYDETILDIGVQPSIKGTKIYAVLKGALDAGL 128          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METKA (50S ribosomal protein L18P OS=Methanopyrus kandleri GN=rpl18p PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.034e-11
Identity = 55/164 (33.54%), Postives = 74/164 (45.12%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHEL-PRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEK 623
            RY+V ++RRREGKT+Y  R  LI  D         R V R T     AQI+  +  GD+ LASA++ EL  ++G +    N  AAY TG L   R L         E  +E                 RA++D+GL +   G+RVF            IPH E+
Sbjct:    9 RYRVPFRRRREGKTNYYKRRELIKADAP-------RLVARKTLNHNIAQIVDFAPHGDVTLASAHSIELRNKFGWKGHCGNTPAAYLTGYLCGLRAL---------ERGIE-----------------RAVIDIGLHRPVRGSRVFAMLKGALDAGMDIPHGEE 139          
The following BLAST results are available for this feature:
BLAST of FC920405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
RL18_METBF5.947e-1230.3050S ribosomal protein L18P OS=Methanosarcina barke... [more]
RL18_DESK15.947e-1235.5150S ribosomal protein L18P OS=Desulfurococcus kamc... [more]
RL18_THEPD7.767e-1237.6850S ribosomal protein L18P OS=Thermofilum pendens ... [more]
RL18_NANEQ7.767e-1230.7250S ribosomal protein L18P OS=Nanoarchaeum equitan... [more]
RL18_HALLT7.767e-1230.0050S ribosomal protein L18P OS=Halorubrum lacusprof... [more]
RL18_METMA1.014e-1130.9150S ribosomal protein L18P OS=Methanosarcina mazei... [more]
RL18_METVS2.260e-1130.6050S ribosomal protein L18P OS=Methanococcus vannie... [more]
RL18_METVA2.260e-1130.6050S ribosomal protein L18P OS=Methanococcus vannie... [more]
RL18_METST5.034e-1132.8450S ribosomal protein L18P OS=Methanosphaera stadt... [more]
RL18_METKA5.034e-1133.5450S ribosomal protein L18P OS=Methanopyrus kandler... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H05EF RVDevelop1 Citrus clementina cDNA clone C32007H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920405 ID=FC920405|Name=FC920405|organism=Citrus clementina|type=EST|length=708bp
GGAGCGTGTTAGGGTTTAAGTACATTGGATTTAGCTCGCGGCTCCTTCAC
AACTTCTCGAACTCTGCTGCTTCTACACTTTGAGCTTCAGCAATGGCCTT
TGCCAAAGCTCAAAAGTCAAAAGCTTACTTTAAGCGATATCAAGTTAAGT
ACAAGAGAAGGCGAGAGGGAAAGACTGACTATCGGGCTAGGATTCGCCTG
ATCAACCAAGATAAAAACAAGTACAACACGCCAAAGTATCGGTTTGTTGT
GCGATTCACCAACAAAGATATCACTGCACAAATTATATCTGCCAGCATAG
CCGGGGATATAGTCCTTGCATCTGCTTATGCCCATGAGCTTCCCCGTTAT
GGTCTTGAGGTGGGCCTCACTAATTATGCAGCAGCTTATTGCACTGGACT
CCTCTTGGCCCGCCGAGTCCTGAAAATGCTTGAGATGGATGCTGAGTATG
AGGGGAACGTTGAGGCAACAGGAGAGGACTATTCAGTTGAGCCAACTGAG
AACAGGAGGCCTTTCCGTGCCCTGCTTGATGTTGGTCTTGTGAAAACAAC
TACTGGTAACCGTGTCTTTGGCGCTCTTAAGGGTGCATTGGATGGTGGAC
TTGATATCCCTCACAGTGAGAAGAGATTTGCTGGATTCAGTAAGGATAGT
AAGCAACTTGACGCTGAAGTTCACCGTAAATACATCTATTGTGGTCGTGT
CGCTGCCT
back to top