FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS7C2_DICDI (Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.646e-42
Identity = 84/112 (75.00%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGR+FSD  +Q DMK WPFKVIA   DKP + V +KGE K F+ EE+SSMVL+KM+E AEAYLG TI NAV+TVPAYFNDSQRQATKDAG IA LNV
Sbjct:   57 VAMNPTNTIFDAKRLIGRKFSDPVIQSDMKHWPFKVIAKEGDKPHLQVEFKGEVKTFSPEEVSSMVLLKMKETAEAYLGKTINNAVITVPAYFNDSQRQATKDAGAIAKLNV 168          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS7C1_DICDI (Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 2.150e-42
Identity = 86/112 (76.79%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGR+FSD  VQ DMK WPFKVI    DKP I V +KGE K F+ EEISSMVL+KM+E AEAYLG TI NAV+TVPAYFNDSQRQATKDAG I+ LNV
Sbjct:   56 VAMNPTNTVFDAKRLIGRKFSDKEVQSDMKHWPFKVIPKDGDKPHIQVEFKGETKVFSPEEISSMVLLKMKETAEAYLGKTINNAVITVPAYFNDSQRQATKDAGTISKLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7A_CAEEL (Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 4.790e-42
Identity = 84/112 (75.00%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F D +VQ DMK WPFKVI+    KP + V YKGE K F  EEISSMVL+KM+E AEA+LG T+K+AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_PARBA (Heat shock 70 kDa protein 2 OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 4.790e-42
Identity = 87/112 (77.68%), Postives = 96/112 (85.71%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP+NTVFDAKRLIGR+F+D  VQ DMK +PFKVI   A KP+I V +KGEEKQF  EEISSMVL KMRE AE+YLG T+ NAVVTVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPSNTVFDAKRLIGRKFADPEVQSDMKHFPFKVI-DKAGKPVISVEFKGEEKQFTPEEISSMVLTKMRETAESYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_LEIDO (Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.790e-42
Identity = 85/112 (75.89%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D+ VQ DMK WPFKV     DKPMI V Y+GEEK F  EEISSMVL+KM+E AEAYLG  +K AVVTVPAYFNDSQRQATKDAG IAGL V
Sbjct:   59 VAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKPMIAVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_EMENI (Heat shock 70 kDa protein OS=Emericella nidulans GN=hsp70 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.790e-42
Identity = 86/112 (76.79%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRF DA VQ DMK WPFKV+   + KP+I V +KGE KQF  EEISSMVL KMRE AEA+LG T+ NAV+TVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPHNTVFDAKRLIGRRFGDAEVQADMKHWPFKVV-DKSGKPIIEVEFKGETKQFTPEEISSMVLTKMRETAEAFLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tschawytscha GN=hsp70 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.256e-42
Identity = 85/112 (75.89%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMK WPFKV++    KP + V+YKGE K F  EEISSMVL+KMREIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPNNTVFDAKRLIGRKFNDQVVQADMKHWPFKVVSD-GGKPKVQVDYKGENKSFNPEEISSMVLVKMREIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_TRIRU (Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.170e-42
Identity = 85/112 (75.89%), Postives = 96/112 (85.71%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+DA VQ DMK +PFKV+   + KP++ V +KGEEKQF  EEISSMVL KMRE AEAYLG T+ NAV+TVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPINTVFDAKRLIGRKFNDAEVQADMKHFPFKVVE-KSGKPIVQVEFKGEEKQFTPEEISSMVLTKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_ACHKL (Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.170e-42
Identity = 81/112 (72.32%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D + Q D+K WPFKV  G  DKP I V +KGE K F  EEISSMVLIKM+E+AEA++G  + NAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   61 VAMNPANTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEVAEAFIGTAVNNAVITVPAYFNDSQRQATKDAGAIAGLNV 172          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HS7C2_DICDI1.646e-4275.00Heat shock cognate 70 kDa protein 2 OS=Dictyosteli... [more]
HS7C1_DICDI2.150e-4276.79Heat shock cognate 70 kDa protein 1 OS=Dictyosteli... [more]
HSP7A_CAEEL4.790e-4275.00Heat shock 70 kDa protein A OS=Caenorhabditis eleg... [more]
HSP72_PARBA4.790e-4277.68Heat shock 70 kDa protein 2 OS=Paracoccidioides br... [more]
HSP70_LEIDO4.790e-4275.89Heat shock 70 kDa protein OS=Leishmania donovani G... [more]
HSP70_EMENI4.790e-4276.79Heat shock 70 kDa protein OS=Emericella nidulans G... [more]
HSP70_ONCTS6.256e-4275.89Heat shock 70 kDa protein OS=Oncorhynchus tschawyt... [more]
HSP70_TRIRU8.170e-4275.89Heat shock 70 kDa protein OS=Trichophyton rubrum G... [more]
HSP70_ACHKL8.170e-4272.32Heat shock 70 kDa protein OS=Achlya klebsiana GN=H... [more]
HSP7C_SAGOE1.067e-4176.79Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top