FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 4.957e-39
Identity = 85/114 (74.56%), Postives = 94/114 (82.46%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGA--TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP +TVFDAKRLIGR+FSD  VQ D+KLWPF+V AG  D P I V+YK EEK F AEEISSMVLIKM+E A+A LGA   +K AVVTVPAYFNDSQRQATKDAG+IAGL V
Sbjct:   60 VAMNPRHTVFDAKRLIGRKFSDPIVQADIKLWPFQVRAGAHDVPEIVVSYKNEEKVFKAEEISSMVLIKMKETAQASLGADREVKKAVVTVPAYFNDSQRQATKDAGMIAGLEV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_CHICK (Heat shock 70 kDa protein OS=Gallus gallus PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.957e-39
Identity = 79/112 (70.54%), Postives = 90/112 (80.36%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGR++ D +VQ DMK WPF+V+     KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  ++ AV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   60 VAMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVV-NEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGKKVETAVITVPAYFNDSQRQATKDAGTITGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS7C3_DICDI (Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.957e-39
Identity = 81/113 (71.68%), Postives = 92/113 (81.42%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPAD-KPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+FSD+ VQ DMK WPFKVI    D KP+I V++KGE K F+ EEISSMVL KM+E AE+YLG  + NAV+TVPAYFND QRQATKDAG I+ LNV
Sbjct:   56 VAMNPINTVFDAKRLIGRKFSDSVVQSDMKHWPFKVITNKNDDKPLIQVDFKGETKTFSPEEISSMVLSKMKETAESYLGKPVNNAVITVPAYFNDGQRQATKDAGTISKLNV 168          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP74_PARLI (Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 6.474e-39
Identity = 78/112 (69.64%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGRRF+D+S+Q DMK WPF+VI     KPM+   Y GE K  + EE+SSMVL KM+E AEAYLG  + +AV+TVPAYFND+QRQATKDAGVIAG+NV
Sbjct:   59 VAMNPTNTIFDAKRLIGRRFNDSSIQADMKHWPFRVI-NKDGKPMLQAEYMGETKTLSPEEVSSMVLTKMKETAEAYLGKKVTSAVITVPAYFNDAQRQATKDAGVIAGINV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_CANAL (Heat shock protein SSA1 OS=Candida albicans GN=SSA1 PE=1 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 8.455e-39
Identity = 83/111 (74.77%), Postives = 91/111 (81.98%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGR+F D  V  D K +PFKVI   A KP+I V YKGE K F+ EEISSMVL KM+EIAE YLG+T+K+AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   58 AMNPANTVFDAKRLIGRKFDDPEVINDAKHFPFKVI-DKAGKPVIQVEYKGETKTFSPEEISSMVLTKMKEIAEGYLGSTVKDAVVTVPAYFNDSQRQATKDAGTIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP68_DROME (Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 8.455e-39
Identity = 80/112 (71.43%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP N+VFDAKRLIGRRF D+ +Q D+K WPFKVI     KP I V +KG  K F+ EEISSMVL KM+E AEAYLG T+K+AV+TVPAYFNDSQRQATKDAG IAG+NV
Sbjct:   56 VAMNPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVI-NDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP76_HUMAN (Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 2.460e-38
Identity = 78/111 (70.27%), Postives = 92/111 (82.88%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGR+F+D +VQ DMK WPF+V++    KP + V Y+GE+K F  EEISSMVL KM+E AEAYLG  +K+AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   62 ALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVS-EGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_PICAN (Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 2.460e-38
Identity = 79/111 (71.17%), Postives = 92/111 (82.88%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGR+F D  VQGD+K +PFKV+   + KP I V +KGE K F  EEISSMVL KM+E AE++LG T+K+AV+TVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   58 AMNPANTVFDAKRLIGRKFDDPEVQGDIKHFPFKVV-DKSGKPQIQVEFKGETKVFTPEEISSMVLTKMKETAESFLGTTVKDAVITVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_ECHGR (Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.460e-38
Identity = 80/112 (71.43%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF D +VQ D+K W FKVI     KP I V Y+GE K F+AEEISSMVL+KM+E AEAYLG  + + V++VPAYFNDSQRQATKDAG I+GLNV
Sbjct:   60 VAMNPTNTVFDAKRLIGRRFDDRAVQDDIKHWAFKVI-NAGGKPKIEVEYRGETKCFSAEEISSMVLLKMKETAEAYLGKKVSDTVISVPAYFNDSQRQATKDAGTISGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_PUCGR (Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.196e-38
Identity = 78/112 (69.64%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+DA VQ D+K +PF V      KP I V Y+GE+K+F+ EEISSM+L KM+E+AE+YLG T+ +AVVTVPAYFNDSQRQATKDAG I+GLNV
Sbjct:   57 VAMNPHNTVFDAKRLIGRKFADAEVQSDIKHFPFTVF-DKGGKPYIRVQYRGEDKEFSPEEISSMILTKMKEVAESYLGGTVTSAVVTVPAYFNDSQRQATKDAGTISGLNV 167          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP70_CHLRE4.957e-3974.56Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]
HSP70_CHICK4.957e-3970.54Heat shock 70 kDa protein OS=Gallus gallus PE=3 SV... [more]
HS7C3_DICDI4.957e-3971.68Heat shock cognate 70 kDa protein 3 OS=Dictyosteli... [more]
HSP74_PARLI6.474e-3969.64Heat shock 70 kDa protein IV OS=Paracentrotus livi... [more]
HSP71_CANAL8.455e-3974.77Heat shock protein SSA1 OS=Candida albicans GN=SSA... [more]
HSP68_DROME8.455e-3971.43Heat shock protein 68 OS=Drosophila melanogaster G... [more]
HSP76_HUMAN2.460e-3870.27Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSP... [more]
HSP72_PICAN2.460e-3871.17Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 ... [more]
HSP70_ECHGR2.460e-3871.43Heat shock cognate 70 kDa protein OS=Echinococcus ... [more]
HSP71_PUCGR4.196e-3869.64Heat shock protein HSS1 OS=Puccinia graminis GN=HS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top