FC920674

Overview
NameFC920674
Unique NameFC920674
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:371..1046. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.486e-94
Identity = 167/204 (81.86%), Postives = 179/204 (87.75%), Query Frame = 3
Query:   93 GKAVNLAPSGNELSNGG-------RISMRKTGSKSVS---SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            G+  +L P  N+L   G       R++MRK  +K ++   S SPWYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE FAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLA+DP AFAE
Sbjct:   14 GQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKLTASASTSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAE 217          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB22_ORYSJ (Chlorophyll a-b binding protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB2R PE=2 SV=2)

HSP 1 Score: 345.51 bits (885), Expect = 1.486e-94
Identity = 174/210 (82.86%), Postives = 183/210 (87.14%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA +TMALSS +  GKA        ++   GRI+MRK+ +K    +SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDP AFAE
Sbjct:    1 MAAATMALSSPALAGKAAA------KVFGEGRITMRKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE 204          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 7.377e-94
Identity = 169/217 (77.88%), Postives = 186/217 (85.71%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVN-LAPSGNELSNGG------RISMRK-TGSKSVSSG--SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA+  +    +F G  ++ + P  N+L   G      R++MRK TG KSV++   SPWYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG+FDPLGLADDP AFAE
Sbjct:    5 MASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGKKSVAASIDSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAE 221          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.643e-93
Identity = 168/217 (77.42%), Postives = 186/217 (85.71%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVN-LAPSGNELSNGG------RISMRK-TGSKSVSSG--SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA+  +    +F G  ++ + P  N+L   G      R++MRK TG KSV++   SPWYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG+FDPLGLADDP AFA+
Sbjct:    5 MASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGRKSVAASIDSPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAD 221          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB22_SOYBN (Chlorophyll a-b binding protein 2, chloroplastic OS=Glycine max GN=CAB2 PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 2.803e-93
Identity = 175/208 (84.13%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA STMALSSS   G+A+ LAPS  EL  G R+SMRKT  K+VSSGSPWYGPDRVKYLGPFSGE PSYLTGEF G        LSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDP A AE
Sbjct:    1 MAASTMALSSSSLAGQAMKLAPSTPELGVG-RVSMRKTAPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFHG--------LSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEALAE 199          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB23_POLMU (Chlorophyll a-b binding protein type 1 member F3, chloroplastic OS=Polystichum munitum GN=CABF3 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 2.901e-90
Identity = 165/212 (77.83%), Postives = 179/212 (84.43%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNELSNG-----GRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MATST AL+S+F G+ +      NELS        R+ M    SK+  SGS WYG DR  YLGPFSG PPSYL+GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAG+QIF+EGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DP+YPGGSFDPLGLADDP AFAE
Sbjct:    1 MATSTAALTSTFSGQQLKPV---NELSRKVGAGEARVQMMAPKSKA-PSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVEDPIYPGGSFDPLGLADDPEAFAE 208          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2_PHYPA (Chlorophyll a-b binding protein, chloroplastic OS=Physcomitrella patens PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 7.145e-89
Identity = 160/213 (75.12%), Postives = 178/213 (83.57%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNELSNG------GRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA +T   S++  G++  L    NELS         R++MR+T SKS  S + WYG DR K+LGPFSGE PSYL GEF GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGC+ PELLA++GVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEVTDP+YPGGSFDPLGLADDP  FAE
Sbjct:    1 MAAATAMHSTALAGQS--LVKPVNELSRKVLGNVEARVTMRRTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAE 211          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 1.592e-88
Identity = 163/210 (77.62%), Postives = 178/210 (84.76%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNEL-----SNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAF 668
            MATST+   S+F G+ + L P  NEL      NGGR+SMR+T   +  S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA+NGVKFGEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWACQVVLMGAVEGYR+ GGPLGE  D LYPGG+FDPLGLA+DP AF
Sbjct:    1 MATSTIQ-QSAFAGQTL-LKPQ-NELVRKVGGNGGRVSMRRTIKSAPES--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF 205          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 325.094 bits (832), Expect = 2.079e-88
Identity = 161/213 (75.59%), Postives = 177/213 (83.10%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNELS------NGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MATS +   S+F G+        NEL        GGR+SMR+T   + +S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWACQVVLMG VEGYR+ GGPLGE  DP+YPGG+FDPLGLADDP AFAE
Sbjct:    1 MATSAIQ-QSAFAGQTA--LKQSNELVCKIGAVGGGRVSMRRTVKSAPTS--IWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAE 208          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_PEA (Chlorophyll a-b binding protein AB96 (Fragment) OS=Pisum sativum GN=AB96 PE=1 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 6.049e-88
Identity = 153/171 (89.47%), Postives = 159/171 (92.98%), Query Frame = 3
Query:  162 TGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            T  K  SS SPW+GPD VKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+ P AFAE
Sbjct:    1 TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAE 171          
The following BLAST results are available for this feature:
BLAST of FC920674 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
CB2B_PINSY1.486e-9481.86Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB22_ORYSJ1.486e-9482.86Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB2A_PINSY7.377e-9477.88Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB2A_PYRPY1.643e-9377.42Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB22_SOYBN2.803e-9384.13Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB23_POLMU2.901e-9077.83Chlorophyll a-b binding protein type 1 member F3, ... [more]
CB2_PHYPA7.145e-8975.12Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_SILPR1.592e-8877.62Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB21_GOSHI2.079e-8875.59Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB21_PEA6.049e-8889.47Chlorophyll a-b binding protein AB96 (Fragment) OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E11EF RVDevelop1 Citrus clementina cDNA clone C32011E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920674 ID=FC920674|Name=FC920674|organism=Citrus clementina|type=EST|length=676bp
GACCTCTCAACACTCGAACACTCGAGCTCACCAACAACTCTGATCATTGC
AAAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGC
TGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCT
CCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTAC
GGCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAG
CTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGC
TTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATC
CACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCT
CTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGG
GAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGC
TTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTT
GATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAG
TGACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCT
GATGACCCCGGAGCTTTTGCTGAGCT
back to top