FC920674

Overview
NameFC920674
Unique NameFC920674
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:371..1046. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2F_SOLLC (Chlorophyll a-b binding protein 3B, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3B PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.583e-26
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 3
Query:  498 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DP AFAE
Sbjct:  152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE 210          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2E_SOLLC (Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3A PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.583e-26
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 3
Query:  498 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DP AFAE
Sbjct:  152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE 210          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.583e-26
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 3
Query:  498 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DP AFAE
Sbjct:    1 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE 59          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2C_SOLLC (Chlorophyll a-b binding protein 1C, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1C PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.583e-26
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 3
Query:  498 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DP AFAE
Sbjct:  150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE 208          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB2A_SOLLC (Chlorophyll a-b binding protein 1A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1A PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.583e-26
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 3
Query:  498 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DP AFAE
Sbjct:  150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE 208          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_RAPSA (Chlorophyll a-b binding of LHCII type 1 protein (Fragment) OS=Raphanus sativus PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.051e-23
Identity = 54/67 (80.60%), Postives = 57/67 (85.07%), Query Frame = 3
Query:  477 LDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            LDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPL    DP AFAE
Sbjct:    1 LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGPLGEAEDLLYPGGSFDPLASLTDPEAFAE 67          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.398e-20
Identity = 72/209 (34.45%), Postives = 97/209 (46.41%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEP-PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGA-QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA+S+   S S VG    LAPS     +G       T S  V+  + W           F G+P P++L G  PGD+G+D  GL+  PE F + +E E+ HCRWAML   G + PE L       G   W KA       +G   YLGNP  +   ++  I A + + +   E  R       +     YPGG+FDPLG + DP  F E
Sbjct:    1 MASSSGLRSCSAVGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEW-----------FPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEAL-------GLGNWVKAQEWAALPDGQATYLGNP--VPWGNLPTILAIEFLAIAFAEQQRTME---KDPEKKKYPGGAFDPLGFSKDPAKFEE 186          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.052e-18
Identity = 58/154 (37.66%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  204 PDRVKYLGPFSGE-PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA-----CQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS-FDPLG 644
            PDR  +   F G  PP +L G  PGD+G+D  GL++DPE+   N++ E++HCRWAMLGA G   PELL + G+      W+ AG Q +      +    +L   + +L  WA       ++  G V    I        TD  YPGG  FDPLG
Sbjct:   63 PDRPLW---FPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGI-LNTPSWYTAGEQEY------FTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLG 206          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.470e-17
Identity = 61/167 (36.53%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  165 GSKSVSSGSPWYGPDRVKYLGPFSGE-PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA-----CQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS-FDPLG 644
            GS+SV+  +    PDR  +   F G  PP +L G  PGD+G+D  GL +DPE+   N + E++H RWAMLGA G   PE L + GV      W+ AG Q +      +    +L   + +L  WA       ++  G V    I        TD  YPGG  FDPLG
Sbjct:   50 GSRSVAVSAVAADPDRPLW---FPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGV-LNTPSWYTAGEQEY------FTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLG 206          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.586e-17
Identity = 57/148 (38.51%), Postives = 74/148 (50.00%), Query Frame = 3
Query:  237 GEP-PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGG-LDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            G+P PSYL G  PGD+G+D+ GL   P    + +E E+IHCRWAML   G + PE L       G   W KA       GG   YLG P  +   ++  I A + + +  VE  R       +     YPGG+FDPLG + DP  F E
Sbjct:   52 GQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEAL-------GLGNWVKAQEWAAIPGGQATYLGQP--VPWGTLPTILAIEFLAIAFVEHQR---SMEKDSEKKKYPGGAFDPLGYSKDPAKFEE 187          
The following BLAST results are available for this feature:
BLAST of FC920674 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
CB2F_SOLLC6.583e-2693.22Chlorophyll a-b binding protein 3B, chloroplastic ... [more]
CB2E_SOLLC6.583e-2693.22Chlorophyll a-b binding protein 3A, chloroplastic ... [more]
CB2D_SOLLC6.583e-2693.22Chlorophyll a-b binding protein 1D (Fragment) OS=S... [more]
CB2C_SOLLC6.583e-2693.22Chlorophyll a-b binding protein 1C, chloroplastic ... [more]
CB2A_SOLLC6.583e-2693.22Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB21_RAPSA1.051e-2380.60Chlorophyll a-b binding of LHCII type 1 protein (F... [more]
CB121_HORVU5.398e-2034.45Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB12_SOLLC5.052e-1837.66Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB12_PETHY1.470e-1736.53Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB11_SOLLC5.586e-1738.51Chlorophyll a-b binding protein 6A, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E11EF RVDevelop1 Citrus clementina cDNA clone C32011E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920674 ID=FC920674|Name=FC920674|organism=Citrus clementina|type=EST|length=676bp
GACCTCTCAACACTCGAACACTCGAGCTCACCAACAACTCTGATCATTGC
AAAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGC
TGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCT
CCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTAC
GGCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAG
CTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGC
TTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATC
CACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCT
CTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGG
GAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGC
TTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTT
GATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAG
TGACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCT
GATGACCCCGGAGCTTTTGCTGAGCT
back to top