FC920691

Overview
NameFC920691
Unique NameFC920691
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length720
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS3_IPOBA (Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.381e-80
Identity = 142/228 (62.28%), Postives = 180/228 (78.95%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATILAIGTA P NC+ Q+ YPDYYFR+TNS+H T LK+KF+R+C+KS + KRY H+TE+ILK+NP+ C Y   SLD+RQDI V EVPKLG+EAA  AIK WGQ KS+ITH++FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T +R+AKD AENN G RVL+VCS++++ TFRGPS+A+L  L GQA     AAA+I+GA+P
Sbjct:    1 MVTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSEAHLDSLVGQALFGDGAAAVIVGADP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS7_IPOBA (Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.803e-80
Identity = 141/228 (61.84%), Postives = 180/228 (78.95%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  ++  G ATILAIGTA P NC+ Q+ YPDYYFR+TNS+H T LK+KF+R+C+KS + KRY H+TE+ILK+NP+ C Y   SLD+RQDI V EVPKLG+EAA  AIKEWGQ KS+ITH+ FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T +R+AKD AENN G RVL+VCS++++ TFRGPS+ +L  L GQA     AAA+I+GA+P
Sbjct:    1 MVTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.803e-80
Identity = 142/228 (62.28%), Postives = 180/228 (78.95%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATILAIGTANP NC+ Q+ YPD+YFR+TNS+H   LKQKF+R+C+KS + +RY ++TE+ILK+NP++C Y   SLD+RQD++V EVP+LG+EAA KAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK+LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAALI+G++P
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKIELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS4_IPOBA (Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.803e-80
Identity = 140/228 (61.40%), Postives = 180/228 (78.95%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  Q+  G ATILAIGT  P NC+ Q+ YPDYYFR+TNS+H T LK++F+R+C+KS + KRY H+TE+ILK+NP+ C Y   SLD+RQDI V EVPKLG+EAA  AIKEWGQ KS+ITH++FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T +R+AKD AENN G RVL+VCS++++ TFRGPS+ +L  L GQA     AAA+I+GA+P
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS9_MEDSA (Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.076e-80
Identity = 140/228 (61.40%), Postives = 181/228 (79.39%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATI+AIGTANP NC+ Q+ YPD+YF++TNS+H   LK+KF+R+C+KS +K+RY ++TE+ILK+NP++C Y   SLD+RQD++V EVP+LG+EAA KAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK+LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAALI+G++P
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS8_MEDSA (Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.076e-80
Identity = 141/228 (61.84%), Postives = 181/228 (79.39%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATILAIGTANP NC+ Q+ YPD+YF++TNS+H T LK+KF+R+C+KS +K+RY ++TE+ILK+NP++C Y   SLD+RQD++V EVP+LG+EAA KAIKEWGQ KS+ITHLI C+  GVDMPGADYQLTK+LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAALI+G++P
Sbjct:    1 MVSVSEIRTAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS4_MEDSA (Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.076e-80
Identity = 141/228 (61.84%), Postives = 181/228 (79.39%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATILAIGTANP NC+ Q+ YPD+YF++TNS+H T LK+KF+R+C+KS +K+RY ++TE+ILK+NP++C Y   SLD+RQD++V EVP+LG+EAA KAIKEWGQ KS+ITHLI C+  GVDMPGADYQLTK+LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAALI+G++P
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS3_MEDSA (Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.076e-80
Identity = 140/228 (61.40%), Postives = 181/228 (79.39%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATI+AIGTANP NC+ Q+ YPD+YF++TNS+H   LK+KF+R+C+KS +K+RY ++TE+ILK+NP++C Y   SLD+RQD++V EVP+LG+EAA KAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK+LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAALI+G++P
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPSNCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 5.247e-80
Identity = 142/228 (62.28%), Postives = 180/228 (78.95%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATILAIGTANPPN + QA YPD+YF++TNS+H   LK+KF+R+C+KS +K RY ++TE+ILK+NP++C Y   SLD+RQD++V EVP+LG+EAA KAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK+LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAALI+G++P
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPPNRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 296.59 bits (758), Expect = 8.950e-80
Identity = 140/228 (61.40%), Postives = 179/228 (78.51%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  Q+  G ATILAIGT+ P NC+ Q+ YPDYYFR+TNS+H T LK+KFKR+C+KS +KKRY H+TE+ILK+NPN+CAY   SLD+RQDI+V EVPKLG+    KAIKEWGQ KS+ITHL+FC+  GVDMP  DYQL K+L + PSVKR+M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPS+++L  L GQA     AAA+IIG++P
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQPKSKITHLVFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGSDP 228          
The following BLAST results are available for this feature:
BLAST of FC920691 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS3_IPOBA1.381e-8062.28Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS7_IPOBA1.803e-8061.84Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-D... [more]
CHS4_PEA1.803e-8062.28Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS4_IPOBA1.803e-8061.40Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS9_MEDSA3.076e-8061.40Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=... [more]
CHS8_MEDSA3.076e-8061.84Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=... [more]
CHS4_MEDSA3.076e-8061.84Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=... [more]
CHS3_MEDSA3.076e-8061.40Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1... [more]
CHS1_TRISU5.247e-8062.28Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHS1_SOLLC8.950e-8061.40Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011G11EF RVDevelop1 Citrus clementina cDNA clone C32011G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920691 ID=FC920691|Name=FC920691|organism=Citrus clementina|type=EST|length=720bp
GGAGACGTGTTCATCAAAATCTCGGTTGAATATATAATGGAGAAAGTTAA
AGATGGGAAGAACCAACAGCAAGGAGGAGGGTTAGCCACGATCCTAGCCA
TCGGCACTGCAAATCCACCAAACTGCATATACCAAGCTGACTACCCTGAT
TATTACTTCCGTGTCACCAACAGTGACCACATGACTCTCCTCAAACAAAA
ATTCAAACGCATCTGCGAGAAATCAAATGTGAAGAAACGCTACTTCCATG
TTACCGAAGATATTCTCAAAAAGAACCCAAATATATGTGCCTACGACGGC
TCCTCCCTCGATAGCCGTCAAGATATATTGGTTAGGGAAGTACCGAAACT
TGGCGAGGAAGCGGCAACAAAAGCAATCAAAGAATGGGGCCAATCAAAAT
CCCAGATCACGCATCTCATTTTCTGCTCACTTGTGGGCGTAGACATGCCC
GGGGCTGACTATCAGCTGACCAAAATGTTGGGCCTCAACCCATCTGTCAA
ACGAGTCATGCTATACTTTCAAGGCTGTTACATTGGCGCCACAGCCATCC
GAATGGCCAAGGACTTTGCTGAAAACAACCCTGGTACCCGCGTTCTAGTC
GTATGCTCTGACTTATCCCTTGGTACTTTCCGTGGACCTTCTGATGCCAA
CTTAGGCTGCCTTGCAGGCCAAGCCCCCTCTTCGCGACGCGCCGCAGCTT
TAATCATTGGCGCTAATCCT
back to top