FC925257
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX2_ARATH (Probable glutathione peroxidase 2 OS=Arabidopsis thaliana GN=GPX2 PE=1 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 3.580e-15 Identity = 43/101 (42.57%), Postives = 57/101 (56.44%), Query Frame = 2 Query: 110 QNPESIFDLSVKDARGHEVDLSTYKG---------------------------------LEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKVDM 313 ++P+SI+D +VKD G++V L YKG LEILAFPCNQF +EPG+N++I VCTRFK+EFPIF+KVD+ Sbjct: 4 ESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDV 104
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX1_PEA (Phospholipid hydroperoxide glutathione peroxidase, chloroplastic OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 2.320e-14 Identity = 32/44 (72.73%), Postives = 40/44 (90.91%), Query Frame = 2 Query: 182 KGLEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKVDM 313 KGLE+LAFPCNQFG +EPGSN++I F CT+FK+EFPIF+KVD+ Sbjct: 131 KGLEVLAFPCNQFGMQEPGSNEEIKQFACTKFKAEFPIFDKVDV 174
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX7_ARATH (Putative glutathione peroxidase 7, chloroplastic OS=Arabidopsis thaliana GN=GPX7 PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 3.958e-14 Identity = 41/98 (41.84%), Postives = 52/98 (53.06%), Query Frame = 2 Query: 119 ESIFDLSVKDARGHEVDLSTYKG---------------------------------LEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKVDM 313 +S+ D +VKD G++V L +KG EILAFPCNQFG +EPGSN +I F CTRFK+EFPIF+KVD+ Sbjct: 74 KSVHDFTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQLYEKYKNQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFDKVDV 171
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX1_ARATH (Phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic OS=Arabidopsis thaliana GN=GPX1 PE=1 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 1.504e-13 Identity = 32/44 (72.73%), Postives = 38/44 (86.36%), Query Frame = 2 Query: 182 KGLEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKVDM 313 +G EILAFPCNQFG +EPGSN +I F CTRFK+EFPIF+KVD+ Sbjct: 131 QGFEILAFPCNQFGFQEPGSNSEIKQFACTRFKAEFPIFDKVDV 174
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX3_ARATH (Probable glutathione peroxidase 3, mitochondrial OS=Arabidopsis thaliana GN=GPX3 PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 9.749e-13 Identity = 39/101 (38.61%), Postives = 54/101 (53.47%), Query Frame = 2 Query: 110 QNPESIFDLSVKDARGHEVDLSTY---------------------------------KGLEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKVDM 313 Q+ SI+++SVKD G +V LS + +G EILAFPCNQFG +EPGSN +I + VC FK+EFPIF+K+++ Sbjct: 43 QSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFPCNQFGSQEPGSNMEIKETVCNIFKAEFPIFDKIEV 143
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX4_HELAN (Probable phospholipid hydroperoxide glutathione peroxidase OS=Helianthus annuus GN=GPXHA-2 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.663e-12 Identity = 38/92 (41.30%), Postives = 49/92 (53.26%), Query Frame = 2 Query: 137 SVKDARGHEVDLSTYKG---------------------------------LEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKVDM 313 S KD +G +V+LS YKG EILAFPCNQFG +EPGSN++I F CTRFK+E+P+F KV++ Sbjct: 26 SDKDVKGQDVELSKYKGKVLLIVNVASQCGFTNSNYPELTTLYQKYKDQGFEILAFPCNQFGGQEPGSNEEIQVFACTRFKAEYPVFSKVNV 117
BLAST of FC925257 vs. ExPASy Swiss-Prot
Match: GPX5_ARATH (Probable glutathione peroxidase 5 OS=Arabidopsis thaliana GN=GPX5 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 6.987e-11 Identity = 35/96 (36.46%), Postives = 49/96 (51.04%), Query Frame = 2 Query: 119 ESIFDLSVKDARGHEVDLSTYKG---------------------------------LEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKV 307 +SI +VKD+ G EVDLS Y+G +LAFPCNQF +EPG++++ F CTRFK+E+P+F+KV Sbjct: 12 KSIHQFTVKDSSGKEVDLSVYQGKVLLVVNVASKCGFTESNYTQLTELYRKYKDQGFVVLAFPCNQFLSQEPGTSEEAHQFACTRFKAEYPVFQKV 107 The following BLAST results are available for this feature:
BLAST of FC925257 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 17
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC925257 ID=FC925257; Name=FC925257; organism=Citrus clementina; type=EST; length=498bpback to top |