FC930834
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC930834 vs. ExPASy Swiss-Prot
Match: WRK13_ARATH (Probable WRKY transcription factor 13 OS=Arabidopsis thaliana GN=WRKY13 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.303e-11 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 2 Query: 578 REPRFAFMTKSEVDHLEDGYRWRKYGQKAVKDSPFPRSYYR 700 REPRF F T SEVD L+DGYRWRKYGQK VK++ PRSYYR Sbjct: 207 REPRFCFKTLSEVDVLDDGYRWRKYGQKVVKNTQHPRSYYR 247
BLAST of FC930834 vs. ExPASy Swiss-Prot
Match: WRK75_ARATH (Probable WRKY transcription factor 75 OS=Arabidopsis thaliana GN=WRKY75 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.702e-11 Identity = 29/41 (70.73%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 578 REPRFAFMTKSEVDHLEDGYRWRKYGQKAVKDSPFPRSYYR 700 ++ R+AF T+S+VD L+DGYRWRKYGQKAVK++ FPRSYYR Sbjct: 51 KKQRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYR 91 The following BLAST results are available for this feature:
BLAST of FC930834 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC930834 ID=FC930834; Name=FC930834; organism=Citrus clementina; type=EST; length=700bpback to top |