BG733596
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BG733596 vs. ExPASy Swiss-Prot
Match: GRP78_MOUSE (78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3) HSP 1 Score: 65.855 bits (159), Expect = 7.510e-11 Identity = 31/63 (49.21%), Postives = 45/63 (71.43%), Query Frame = -3 Query: 2 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARF 190 HF++ +K+K KD+ + RA+++LR E+AKR LSS Q IEI+S +EG DF T+TRA+F Sbjct: 266 HFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKF 328
BLAST of BG733596 vs. ExPASy Swiss-Prot
Match: GRP78_MESAU (78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.510e-11 Identity = 31/63 (49.21%), Postives = 45/63 (71.43%), Query Frame = -3 Query: 2 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARF 190 HF++ +K+K KD+ + RA+++LR E+AKR LSS Q IEI+S +EG DF T+TRA+F Sbjct: 265 HFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKF 327
BLAST of BG733596 vs. ExPASy Swiss-Prot
Match: GRP78_CHICK (78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.510e-11 Identity = 31/63 (49.21%), Postives = 45/63 (71.43%), Query Frame = -3 Query: 2 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARF 190 HF++ +K+K KD+ + RA+++LR E+AKR LSS Q IEI+S +EG DF T+TRA+F Sbjct: 263 HFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKF 325
BLAST of BG733596 vs. ExPASy Swiss-Prot
Match: HSP7C_DROME (Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.809e-11 Identity = 31/63 (49.21%), Postives = 45/63 (71.43%), Query Frame = -3 Query: 2 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARF 190 HF++ +K+K KDI + RA+++LR E+AKR LS + Q IEI+S +EG DF T+TRA+F Sbjct: 265 HFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKF 327 The following BLAST results are available for this feature:
BLAST of BG733596 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 154
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BG733596 ID=BG733596; Name=BG733596; organism=Citrus sinensis; type=EST; length=204bpback to top |