BQ622910

Overview
NameBQ622910
Unique NameBQ622910
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length538
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9906 contig Csv1_Contig9906:695..1232. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 196.823 bits (499), Expect = 5.397e-50
Identity = 91/177 (51.41%), Postives = 124/177 (70.06%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E YKGF+ +  +VDV            SKYP IKGINFD+ HVI+DA +YPG+EHVG DM+  +P+ DAI MKW+ H++ DE+C+K L+NCY+ALP +GKVLV    LPE PD++ A++++  +D + L   P G+ERT+KEF ALA  AG
Sbjct:  163 GTDPRFNKVFNRGMSDHSTMTMKKILEDYKGFEGLNSIVDVGGGTGATVNMIVSKYPSIKGINFDLSHVIEDAPAYPGVEHVGRDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPANGKVLVAECILPETPDTSAATKNAVHVDIVMLAHNPGGKERTEKEFEALAKGAG 339          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 7.048e-50
Identity = 89/177 (50.28%), Postives = 125/177 (70.62%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T +VDV            SKYP IKGINFD+PHVI+DA  YPG++HVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP++GKV++    LP  PD++ A++    +D + L   P G+ERT++EF ALA  +G
Sbjct:  167 GTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSIKGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDVVMLAHNPGGKERTEQEFEALAKGSG 343          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.202e-49
Identity = 93/177 (52.54%), Postives = 120/177 (67.80%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI E Y GF+ +  +VDV            +KYP IKGINFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP  GKV+V    LP  PD + A++    +DAI L   P G+ERT+KEF ALAI AG
Sbjct:  172 GTDPRFNKVFNRGMSDHSTITMKKIFEMYTGFEALNTIVDVGGGTGAVLSMIVAKYPSIKGINFDLPHVIEDAPIYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPEHGKVIVAECILPLSPDPSLATKGVIHIDAIMLAHNPGGKERTEKEFEALAIGAG 348          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_CAPCH (Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.498e-49
Identity = 89/173 (51.45%), Postives = 121/173 (69.94%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALA 524
            GTD RFN+VFN GM   T+  + KI+E Y GF+ +  +VDV            SKYP IKGINFD+PHVI+DA SYPG+E VGGDM+  +P+ DAI MKW+ H++ D++CIK+L+NCY+ALP +GKV+++   LPE PD++ A++     D I L   P G+ERT+K+F ALA
Sbjct:  163 GTDPRFNKVFNCGMSDHTTLSMKKILEDYTGFEGLNSIVDVGGGTGATVNMIVSKYPSIKGINFDLPHVIRDAPSYPGVEQVGGDMFVSVPKADAIFMKWICHDWSDDHCIKLLKNCYEALPANGKVIIVECILPEAPDTSAATKSKVHGDIIMLAHNPGGKERTEKDFEALA 335          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT3_POPKI (Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 4.569e-49
Identity = 89/177 (50.28%), Postives = 122/177 (68.93%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   +   + KI+ESYKGF+ +  LVDV            SKYP IKGINFD+PHVI DA ++PG+E+VGGDM+  +P+ DA+ MKW+ H++ DE+C+++L+NCY ALP +GKV+++   LP  PD++ A++    +DAI L   P G+ERT KEF  LA  AG
Sbjct:  166 GTDPRFNKVFNKGMSDHSKMAMKKILESYKGFEGLASLVDVGGGTGAVVSTIVSKYPSIKGINFDLPHVIADAPAFPGVENVGGDMFVSVPKADAVFMKWICHDWSDEHCLRLLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDAIMLAHNPGGKERTDKEFEGLARGAG 342          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT2_OCIBA (Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 4.569e-49
Identity = 88/177 (49.72%), Postives = 121/177 (68.36%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+Y GF  +  +VDV            SKYP IKGINFD+PHV++DA SYPG+EHVGGDM+  +P+GDAI MKW+ H++ D +C+K L+ CY+ALP +GKV++    LPE PD+  A+++   +D I L   P G+ERT+KEF  LA  +G
Sbjct:  165 GTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIISKYPSIKGINFDLPHVVEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDAHCVKFLKKCYEALPENGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQVLAKASG 341          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.329e-48
Identity = 87/177 (49.15%), Postives = 126/177 (71.19%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E Y+GF+ +  +VDV            SKYP IKGINF++PHV++DA S+ G+EHVGGDM+  +P+GDAI MKW+ H++ D++C K+L+NCY+ALP++GKV++    LPE PD++ A+++   +D + L   P G+ERT+KEF ALA  AG
Sbjct:  154 GTDPRFNKVFNQGMSNHSTITMKKILEVYRGFEGLKTVVDVGGGTGATLNMIISKYPTIKGINFELPHVVEDAPSHSGVEHVGGDMFVSVPKGDAIFMKWICHDWSDDHCRKLLKNCYQALPDNGKVILAECVLPEAPDTSLATQNVVHVDVVMLAHNPGGKERTEKEFEALAKGAG 330          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGU (Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 6.597e-48
Identity = 87/177 (49.15%), Postives = 121/177 (68.36%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN++FN GM   ++  + KI+E+YKGF+ +  +VDV            +KYP +KGINFD+PHVI+DA   PG++HVGGDM+  +P+GDAI MKW+ H++ D++C K L+NCY ALPN GKV+V    LP  PD++ A+++   +D I L   P G+ERT+KEF  LA  AG
Sbjct:  168 GTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSMKGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNIGKVIVAECVLPVYPDTSLATKNVIHIDCIMLAHNPGGKERTQKEFETLAKGAG 344          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT2_POPTM (Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.274e-47
Identity = 86/177 (48.59%), Postives = 120/177 (67.80%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   +   + KI+E+YKGF+ +  LVDV            SKYP IKGINFD+PHVI DA ++PG+E+VGGDM+  +P+ DA+ MKW+ H++ DE+C+  L+NCY ALP +GKV+++   LP  PD++ A++    +D I L   P G+ERT +EF +LA  AG
Sbjct:  166 GTDPRFNKVFNKGMSVHSKMAMKKILETYKGFEGLASLVDVGGGTGAVVSTIVSKYPSIKGINFDLPHVIADAPAFPGVENVGGDMFVSVPKADAVFMKWICHDWSDEHCLTFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDVIMLAHNPGGKERTDREFESLARGAG 342          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: IEMT_CLABR ((Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 9.526e-47
Identity = 85/177 (48.02%), Postives = 121/177 (68.36%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E Y GF+ +T +VDV            +KYP I  INFD+PHVI+DA ++ G+EH+GGDM+  +P+GDAI +KW+ H++ DE+C+K+L+NCY ALP+ GKV+V    LP  PD + A++     DA+ L   P G+ERT+KEF ALA+ +G
Sbjct:  170 GTDHRFNKVFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPHVIQDAPAFSGVEHLGGDMFDGVPKGDAIFIKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQALAMASG 346          
The following BLAST results are available for this feature:
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
COMT1_CAPAN5.397e-5051.41Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]
COMT1_ROSCH7.048e-5050.28Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
COMT1_CLABR1.202e-4952.54Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_CAPCH3.498e-4951.45Caffeic acid 3-O-methyltransferase OS=Capsicum chi... [more]
COMT3_POPKI4.569e-4950.28Caffeic acid 3-O-methyltransferase 3 OS=Populus ki... [more]
COMT2_OCIBA4.569e-4949.72Caffeic acid 3-O-methyltransferase 2 OS=Ocimum bas... [more]
COMT1_COFCA1.329e-4849.15Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
COMT1_EUCGU6.597e-4849.15Caffeic acid 3-O-methyltransferase OS=Eucalyptus g... [more]
COMT2_POPTM3.274e-4748.59Caffeic acid 3-O-methyltransferase 2 OS=Populus tr... [more]
IEMT_CLABR9.526e-4748.02(Iso)eugenol O-methyltransferase OS=Clarkia brewer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00001 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00001 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622910 ID=BQ622910|Name=BQ622910|organism=Citrus sinensis|type=EST|length=538bp
ATCTGGGCACCGACTCCAGGTTCAATGAAGTTTTCAACAATGGAATGATC
GGCCAGACTTCTTTTGTAATCAATAAGATTGTAGAATCCTACAAAGGCTT
TCAGAATATTACGCGCCTTGTTGACGTTGGCGGTGGTTTAGGAATCACCC
TTGCGACCATAATTTCCAAATACCCTCATATTAAGGGTATTAATTTTGAC
GTACCTCATGTTATAAAAGATGCCTCATCTTATCCCGGCATGGAACATGT
TGGCGGAGATATGTACCAAAAAATTCCAGAGGGGGATGCCATTTTAATGA
AGTGGATGCTTCATAATTTTGATGATGAGAATTGCATAAAGATACTGAGG
AATTGTTACAAAGCTCTTCCAAATGATGGAAAGGTACTTGTTATTAACTC
AACGTTGCCAGAAGTGCCTGACAGTACCGAGGCTTCAAGGGATTCCTTCA
TTTTAGATGCAATTTTTTTAATCCAAATTCCTCATGGAAGGGAGCGGACC
AAAAAGGAGTTCACTGCATTGGCAATCGAAGCTGGATT
back to top