BQ622910

Overview
NameBQ622910
Unique NameBQ622910
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length538
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9906 contig Csv1_Contig9906:695..1232. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: 7OMT6_MEDSA (Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.121e-22
Identity = 55/181 (30.39%), Postives = 98/181 (54.14%), Query Frame = 3
Query:    3 LGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPND---GKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            L  +  +N  FN+ M   +  +   + +    F  +  +VDV              +P +K I FD P V+++ S    + +VGGDM+  IP  DA+L+K++LHN+ D++C++IL+ C +A+ ND   GKV +I+  + E  D  + ++   ++D    +   +G+ER ++E+  L IEAG
Sbjct:  154 LDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDEKKDENQVTQIKLLMDV--NMACLNGKERNEEEWKKLFIEAG 332          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: 7OMT9_MEDSA (Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.061e-21
Identity = 55/181 (30.39%), Postives = 98/181 (54.14%), Query Frame = 3
Query:    3 LGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPND---GKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            L  +  +N  FN+ M   +  +   + +    F  +  +VDV              +P +K I FD P V+++ S    + +VGGDM+  IP  DA+L+K++LHN+ D++C++IL+ C +A+ ND   GKV +I+  + E  D  + ++   ++D    +   +G+ER ++E+  L IEAG
Sbjct:  154 LDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVINEKKDENQVTQIKLLMDV--NMACLNGKERNEEEWKKLFIEAG 332          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: 7OMT8_MEDSA (Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.363e-21
Identity = 54/181 (29.83%), Postives = 98/181 (54.14%), Query Frame = 3
Query:    3 LGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPND---GKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            L  +  +N  FN+ M   +  +   + +    F  +  +VDV              +P +K I FD P V+++ S    + +VGGDM+  IP  DA+L+K++LHN+ D++C++IL+ C +A+ ND   GKV +I+  + +  D  + ++   ++D    +   +G+ER ++E+  L IEAG
Sbjct:  154 LDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDV--NMACLNGKERNEEEWKKLFIEAG 332          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT12_DICDI (O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.820e-20
Identity = 52/182 (28.57%), Postives = 97/182 (53.30%), Query Frame = 3
Query:    9 TDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASS------YPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            TD  + ++F+N M   TS +I++++       N   +VD+               P+I GINFD+ ++I  ++S      +P ++HV GD +  +PE D  ++K++LH++ DE CI IL N +K+L  +GK+ + +  L    D +  ++++   D I ++Q    +ER+  E+  L  + G
Sbjct:  141 TDESYKQLFHNAMKDYTSLIIDRLISKISLSPNFKTVVDIGGSHGFLIGKLLESNPNIHGINFDLENIINSSTSKNENFQHPRLKHVSGDFFNSVPEADCYILKYILHDWSDEKCITILNNIHKSLKPNGKLFINDLVL----DPSNYTKEAVFKD-ILMMQYFDAKERSINEWHQLFEKCG 317          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COOMT_COPJA (Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.098e-18
Identity = 59/180 (32.78%), Postives = 94/180 (52.22%), Query Frame = 3
Query:   12 DSRFNEVFNNGMIGQTSFVINKIVESYKG---FQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPN-DGKVLVINSTL--PEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEA 533
            D   NE+ N+ M   ++F++  +V           +  +VDV              +PH+K    D+ HVI+     P +++V GDM+  IP  DAIL+K  LHN++D++CIKIL    +ALP+  GKV+++   +    +P  T A R S  +D + +     G+ERTKKE+  L  +A
Sbjct:  156 DPEINEILNDAMTSHSTFMLPALVSGLMKENVLDGVASIVDVGGNSGVVAKGIVDAFPHVKCSVMDLNHVIERVIKNPKLDYVAGDMFTSIPNADAILLKSTLHNYEDDDCIKILNIAKEALPSTGGKVILVEIVVDTENLPLFTSA-RLSMGMDMMLM----SGKERTKKEWEDLLRKA 330          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: CVMT1_OCIBA (Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.611e-17
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 3
Query:   33 FNNGMIGQTSFVINKIVESYKG-FQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            F+  M   +  V + + + YK     I  LVDV               P +K    D+PHV+    S   + ++GGDM+Q IP  DAIL+K+++H++DDE  +KIL+ C  A+   GKV++I+  +    D  E   D    D + ++   + +ERT  E+  L   AG
Sbjct:  169 FDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKDAVGIGGKVIIIDVVVGVNHDVDEVLEDQLHFD-MAMMSYFNAKERTMNEWEKLISAAG 336          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: EOMT1_OCIBA (Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.022e-17
Identity = 52/169 (30.77%), Postives = 81/169 (47.93%), Query Frame = 3
Query:   33 FNNGMIGQTSFVINKIVESYKG-FQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            F+  M   +  + +   + YK   + I  LVDV               P IK    D+PHV+    S   + ++GGDM+Q IP  DAIL+K ++H++DD   +KIL+ C  A+   GKV++I+  +    D  E   D    D   +    + +ERT  E+  L  +AG
Sbjct:  170 FDEAMSCDSRLIAHVFTKDYKHVIEGIRTLVDVGGGNGTMAKAIVEAMPTIKCTVIDLPHVVAGLESTDNLNYIGGDMFQSIPSADAILLKSIIHDWDDVEGLKILKKCKDAVVMGGKVIIIDVVVGVNHDIDEVLEDQLHFDMAMMCYF-NAKERTMSEWEKLIYDAG 337          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT11_DICDI (Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.342e-16
Identity = 48/170 (28.24%), Postives = 90/170 (52.94%), Query Frame = 3
Query:   21 FNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASS---YPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTAL 521
            +   FN+GMIG T+ ++ K ++          +VD+             +YP++ GINFD   VI  ++    +P ++HV GD ++ +PE D  LMK +L  F DE C ++L+   K++ ++ K+++++  L    DS++       LD I +++   G++R+  E+  L
Sbjct:  144 YKNEFNDGMIGYTTHIL-KFLKGKIDLSKFETVVDIGGSHGYLIGSLLDRYPNVNGINFDTDMVINSSNEKYQHPRLKHVAGDFFKSVPEADCYLMKLILRCFSDEKCCELLKIISKSMKSNAKIIILDIIL----DSSKYLNFDTYLD-ILMMETLDGKQRSLSEWIKL 307          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT4_DICDI (O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.142e-14
Identity = 48/173 (27.75%), Postives = 85/173 (49.13%), Query Frame = 3
Query:   27 EVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSY---PGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            E F N M   +S  I   ++ +  F    ++VD+             KYP+  GINFD+      A      P +EH  G+ ++ +PEGD  ++K +LH++ DE+CIKIL    K++   GKV++ +  +    +    ++    LD + +       E+T K+F+ ++ +AG
Sbjct:  151 EFFKNAMKVSSSEAIESALK-FIDFSPFKKIVDIGGSHGRFVCEILEKYPNSHGINFDLESFFNGAGELIKNPRLEHKSGNFFESVPEGDCYILKRILHDWKDEDCIKILETIGKSILPGGKVIIFDCII----NPKNYNKGHLYLD-VMMFHFFGSEEKTIKQFSNISDKAG 317          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT9_DICDI (O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.890e-13
Identity = 49/176 (27.84%), Postives = 90/176 (51.14%), Query Frame = 3
Query:   18 RFNEVFNNGMIGQTSFVINKIVESYKG--FQNITRLVDVXXXXXXXXXXXXSKYPHIK-GINFDVPHVIKDAS-----SYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTAL 521
            ++ ++FN  M   T   I+ I +S KG  F     +VD+              YP IK GINFD+  VI  +      S+P + H+ G+ ++ +PE D  +MK++LH++  ++C+KIL+   K++  + K+ +    +   P    +  +++I   I + Q+ + +ERT  E+  L
Sbjct:  162 QYKDLFNQTMKVYTEAAISNITQS-KGIDFSQYDTVVDIGGNHGLLIGNLLEIYPTIKHGINFDLDVVINSSDQTLRYSHPRLTHIPGNFFESVPESDCYIMKFILHDWPTQDCVKILKTISKSMKPNAKIHLFEIIID--PRKGYSKYETYI--DILMFQMVNAKERTLDEWKEL 332          
The following BLAST results are available for this feature:
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
7OMT6_MEDSA8.121e-2230.39Isoflavone-7-O-methyltransferase 6 OS=Medicago sat... [more]
7OMT9_MEDSA1.061e-2130.39Isoflavone-7-O-methyltransferase 9 OS=Medicago sat... [more]
7OMT8_MEDSA2.363e-2129.83Isoflavone-7-O-methyltransferase 8 OS=Medicago sat... [more]
OMT12_DICDI5.820e-2028.57O-methyltransferase 12 OS=Dictyostelium discoideum... [more]
COOMT_COPJA1.098e-1832.78Columbamine O-methyltransferase OS=Coptis japonica... [more]
CVMT1_OCIBA4.611e-1731.36Chavicol O-methyltransferase OS=Ocimum basilicum G... [more]
EOMT1_OCIBA6.022e-1730.77Eugenol O-methyltransferase OS=Ocimum basilicum GN... [more]
OMT11_DICDI1.342e-1628.24Probable inactive O-methyltransferase 11 OS=Dictyo... [more]
OMT4_DICDI2.142e-1427.75O-methyltransferase 4 OS=Dictyostelium discoideum ... [more]
OMT9_DICDI6.890e-1327.84O-methyltransferase 9 OS=Dictyostelium discoideum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00001 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00001 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622910 ID=BQ622910|Name=BQ622910|organism=Citrus sinensis|type=EST|length=538bp
ATCTGGGCACCGACTCCAGGTTCAATGAAGTTTTCAACAATGGAATGATC
GGCCAGACTTCTTTTGTAATCAATAAGATTGTAGAATCCTACAAAGGCTT
TCAGAATATTACGCGCCTTGTTGACGTTGGCGGTGGTTTAGGAATCACCC
TTGCGACCATAATTTCCAAATACCCTCATATTAAGGGTATTAATTTTGAC
GTACCTCATGTTATAAAAGATGCCTCATCTTATCCCGGCATGGAACATGT
TGGCGGAGATATGTACCAAAAAATTCCAGAGGGGGATGCCATTTTAATGA
AGTGGATGCTTCATAATTTTGATGATGAGAATTGCATAAAGATACTGAGG
AATTGTTACAAAGCTCTTCCAAATGATGGAAAGGTACTTGTTATTAACTC
AACGTTGCCAGAAGTGCCTGACAGTACCGAGGCTTCAAGGGATTCCTTCA
TTTTAGATGCAATTTTTTTAATCCAAATTCCTCATGGAAGGGAGCGGACC
AAAAAGGAGTTCACTGCATTGGCAATCGAAGCTGGATT
back to top