BQ622910

Overview
NameBQ622910
Unique NameBQ622910
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length538
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9906 contig Csv1_Contig9906:695..1232. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT7_DICDI (O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.535e-12
Identity = 45/174 (25.86%), Postives = 86/174 (49.43%), Query Frame = 3
Query:    9 TDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASS---YPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTAL 521
            T+  F   FN  M   ++  I  I+++   F +   +VDV             KY ++ GI FD+  VI  +     +P +E+V G  ++ +P  D  ++K +LH++DDE C++IL+   K++  + K+ + +    E+ D  +  + S  LD + +    + RER+  ++  L
Sbjct:  147 TNEHFKYSFNQEMREFSNLSIPTIIKN-TDFSSFNTVVDVGGSHGRIVGELVKKYENLNGIVFDLETVINSSIEKIKHPRIEYVSGSFFESVPSADCYVLKNILHDWDDEKCLEILKTISKSMKENSKIFIFD----EIIDPNDYRKLSLFLD-VTVFHFFNSRERSLNDWKQL 314          
The following BLAST results are available for this feature:
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
OMT7_DICDI1.535e-1225.86O-methyltransferase 7 OS=Dictyostelium discoideum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00001 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00001 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622910 ID=BQ622910|Name=BQ622910|organism=Citrus sinensis|type=EST|length=538bp
ATCTGGGCACCGACTCCAGGTTCAATGAAGTTTTCAACAATGGAATGATC
GGCCAGACTTCTTTTGTAATCAATAAGATTGTAGAATCCTACAAAGGCTT
TCAGAATATTACGCGCCTTGTTGACGTTGGCGGTGGTTTAGGAATCACCC
TTGCGACCATAATTTCCAAATACCCTCATATTAAGGGTATTAATTTTGAC
GTACCTCATGTTATAAAAGATGCCTCATCTTATCCCGGCATGGAACATGT
TGGCGGAGATATGTACCAAAAAATTCCAGAGGGGGATGCCATTTTAATGA
AGTGGATGCTTCATAATTTTGATGATGAGAATTGCATAAAGATACTGAGG
AATTGTTACAAAGCTCTTCCAAATGATGGAAAGGTACTTGTTATTAACTC
AACGTTGCCAGAAGTGCCTGACAGTACCGAGGCTTCAAGGGATTCCTTCA
TTTTAGATGCAATTTTTTTAATCCAAATTCCTCATGGAAGGGAGCGGACC
AAAAAGGAGTTCACTGCATTGGCAATCGAAGCTGGATT
back to top