BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2SA_XENLA (Ubiquitin-conjugating enzyme E2 S-A OS=Xenopus laevis GN=ube2s-A PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 6.453e-25
Identity = 57/138 (41.30%), Postives = 77/138 (55.80%), Query Frame = 2
Query:  170 ILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQ 583
            + KE+  L  DPP      P  ED+   Q TI GP  +PYAGG+F + +    D+P  PPK  F TK+FHPN+  NG IC+++LK  W+  L I  VLL+I  LL  PNP+  L  E   +   +  +Y A AR  T+
Sbjct:   16 VYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTE 153          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2C_DROME (Ubiquitin-conjugating enzyme E2 C OS=Drosophila melanogaster GN=vih PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.101e-24
Identity = 57/143 (39.86%), Postives = 88/143 (61.54%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKY 589
            SKR+ KEL +L        SA P  E++F W  TI GP ++ Y+G  + +++ FP  YP+  P V F T  FHPN++  G+ICLDILK++WS    +  +LLSI SLL +PN + PL  + A M+ +D+ +Y+    ++ +K+
Sbjct:   34 SKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMW-NDQKEYKKYLDAFYEKH 175          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC9_SCHPO (SUMO-conjugating enzyme ubc9 OS=Schizosaccharomyces pombe GN=hus5 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.438e-24
Identity = 57/155 (36.77%), Postives = 87/155 (56.13%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAE-----DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ--WSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            S +   R+ +E K  ++D P    A P        D+ +W+  I G P + + GG++ +T+ FP +YP +PPK  F   +FHPN+  +G++CL IL E+  W PA+TI ++LL I  LL DPN   P   E   M+K DK +YE   R+  ++ A
Sbjct:    2 SSLCKTRLQEERKQWRRDHPFGFYAKPCKSSDGGLDLMNWKVGIPGKPKTSWEGGLYKLTMAFPEEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEGWKPAITIKQILLGIQDLLDDPNIASPAQTEAYTMFKKDKVEYEKRVRAQARENA 156          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC7_CAEEL (Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.438e-24
Identity = 54/148 (36.49%), Postives = 90/148 (60.81%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            +S  + K+L D+++ P    SAG V + D++ W+  ++GPPD+ Y GG F   + FP DYP KPPK+ F ++++HPNI+  G++C+ IL             +E+W P  T+  +LLS+ S+LTDPN + P   + A M + + A+++
Sbjct:    4 SSLLLKKQLADMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFESPANVDAAKMQRENYAEFK 151          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC_ASFM2 (Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=UBC PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.452e-24
Identity = 59/157 (37.58%), Postives = 87/157 (55.41%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-----KEQ---WSPALTISKVLLSICSLLTDPNPDDPLVPEIA-----HMYKSDKAKYEATARSWTQK 586
            M S  +L E K+L  +P          +++  W   + GPPD+ Y GG+F   I FPP YP++PP++ F ++++HPNI S+G +C+ IL     +EQ   WSPA  I  VLLS+ SLL +PNPD P   + A     ++YK D   Y    +   +K
Sbjct:    1 MVSSFLLAEYKNLIVNPSEHFKISVNEDNLTEWDVILKGPPDTLYEGGLFKAKIVFPPKYPYEPPRLTFTSEMWHPNIYSDGKLCISILHGDNAEEQGMTWSPAQKIDTVLLSVISLLNEPNPDSPANVDAAKSYRKYLYKEDLESYPMEVKKTVKK 157          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC15_SCHPO (Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe GN=ubc15 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.452e-24
Identity = 54/153 (35.29%), Postives = 90/153 (58.82%), Query Frame = 2
Query:  158 ASKRIL-KELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-------------EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATAR 571
            AS+++L K+LK++QK+PP   S G V +  +F W+  I+GP D+ Y GG F  T+ FP DYP  PPK+ F T+++HPN++ NG +C+ IL              E+W P  +   +L+S+ S+L+ PN + P   + A  ++ +  +++   R
Sbjct:    5 ASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSSPNDESPANIDAAKEFRENPQEFKKRVR 157          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC11_SCHPO (Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe GN=ubc11 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.203e-24
Identity = 51/134 (38.06%), Postives = 82/134 (61.19%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            +KR+  EL  L        SA P ++ ++ HW  TI GP D+ Y G  F +++ FP +YP+ PP + F + ++HPN++ +G+ICLDILK++WS    +  +LLS+ SLL +PN   PL  + A ++  D  +Y+
Sbjct:   30 TKRLRSELMSLMMSNTPGISAFPDSDSNLLHWAGTITGPSDTYYEGLKFKISMSFPANYPYSPPTIIFTSPMWHPNVDMSGNICLDILKDKWSAVYNVQTILLSLQSLLGEPNNASPLNAQAAELWSKDPIEYK 163          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2S_DROGR (Ubiquitin-conjugating enzyme E2 S OS=Drosophila grimshawi GN=GH12079 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.463e-24
Identity = 57/143 (39.86%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++++KEL+D++  PP          D+   QA I GP  +PYA G+F V +    D+P  PPK  F TK+FHPN+ SNG IC++ LK+ W P L I  +LL+I  LL  PNP+  L  E   M       Y   AR  T+ +A
Sbjct:   17 RQVMKELQDMESTPPEGIKVLINESDVTDIQALIDGPAGTPYAVGIFRVKLTLSKDFPQTPPKAYFLTKIFHPNVASNGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRARMMTEIHA 159          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2S_DROVI (Ubiquitin-conjugating enzyme E2 S OS=Drosophila virilis GN=GJ15767 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.135e-24
Identity = 58/143 (40.56%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++++KEL+D++  PP          D+   QA I GP  +PYA GVF V +    D+P  PPK  F TK+FHPN+ SNG IC++ LK+ W P L I  +LL+I  LL  PNP+  L  E   M       Y   AR  T+ +A
Sbjct:   17 RQVMKELQDMETTPPEGIKVLINESDVTDIQAFIDGPAGTPYAVGVFRVKLTLSKDFPQTPPKAYFLTKIFHPNVASNGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRARMMTEIHA 159          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2S_DANRE (Ubiquitin-conjugating enzyme E2 S OS=Danio rerio GN=ube2s PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 9.318e-24
Identity = 55/143 (38.46%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  170 ILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            + KE+  L  DPP      P  ED+     +I GP  +PYAGGVF + +    D+P  PP+  F TK+FHPN+   G IC+++LK  W   L +  VLL+I  LL  PNP+  L  E   +   D  +Y + A   T+ +AMG
Sbjct:   16 VYKEVSALAADPPEGIKIYPSEEDITELHTSIEGPEGTPYAGGVFRMRLVLGKDFPAVPPRGYFLTKIFHPNVGHKGEICVNVLKRDWKAELGLRHVLLTIKCLLIHPNPESALNEEAGKLLLEDYKEYASRAHLLTEIHAMG 158          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2SA_XENLA6.453e-2541.30Ubiquitin-conjugating enzyme E2 S-A OS=Xenopus lae... [more]
UBE2C_DROME1.101e-2439.86Ubiquitin-conjugating enzyme E2 C OS=Drosophila me... [more]
UBC9_SCHPO1.438e-2436.77SUMO-conjugating enzyme ubc9 OS=Schizosaccharomyce... [more]
UBC7_CAEEL1.438e-2436.49Probable ubiquitin-conjugating enzyme E2 7 OS=Caen... [more]
UBC_ASFM22.452e-2437.58Ubiquitin-conjugating enzyme E2 OS=African swine f... [more]
UBC15_SCHPO2.452e-2435.29Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccha... [more]
UBC11_SCHPO3.203e-2438.06Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosa... [more]
UBE2S_DROGR5.463e-2439.86Ubiquitin-conjugating enzyme E2 S OS=Drosophila gr... [more]
UBE2S_DROVI7.135e-2440.56Ubiquitin-conjugating enzyme E2 S OS=Drosophila vi... [more]
UBE2S_DANRE9.318e-2438.46Ubiquitin-conjugating enzyme E2 S OS=Danio rerio G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top