BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_KLULA (Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 5.101e-30
Identity = 58/148 (39.19%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +++D P   SA P+ +++  W A I+GP D+PY  G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A +++  K++Y     E   +SW
Sbjct:    2 STPARRRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC27_ARATH (Ubiquitin carrier protein E2 27 OS=Arabidopsis thaliana GN=UBC27 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 6.663e-30
Identity = 66/144 (45.83%), Postives = 94/144 (65.28%), Query Frame = 2
Query:  167 RILKELKDLQKDPPTS-CSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            RI KEL+D +++  +S     P ++++     TI GP  +PY GG F + I  P  YPF+PPK+ F TKV+HPNI+S +G+ICLDILK+QWSPALT+   L+SI +LL+ P P DP    +A  Y  +   + +TAR WT+ +A
Sbjct:    6 RIQKELQDCERNQDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQYMKNYQVFVSTARYWTETFA 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2K_MOUSE (Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=2 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 1.939e-29
Identity = 67/150 (44.67%), Postives = 92/150 (61.33%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTS---CSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            +A +RI +E K++ K   TS        V E+    +  I GPPD+PY GG + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+  VLLS+ +LL    PDDP    +A+ YK +   ++ TAR W   YA
Sbjct:    4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 153          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2K_HUMAN (Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens GN=UBE2K PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 1.939e-29
Identity = 67/150 (44.67%), Postives = 92/150 (61.33%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTS---CSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            +A +RI +E K++ K   TS        V E+    +  I GPPD+PY GG + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+  VLLS+ +LL    PDDP    +A+ YK +   ++ TAR W   YA
Sbjct:    4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 153          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2K_BOVIN (Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN=UBE2K PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 1.939e-29
Identity = 67/150 (44.67%), Postives = 92/150 (61.33%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTS---CSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            +A +RI +E K++ K   TS        V E+    +  I GPPD+PY GG + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+  VLLS+ +LL    PDDP    +A+ YK +   ++ TAR W   YA
Sbjct:    4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 153          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_CRYNE (Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans GN=UBC2 PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.532e-29
Identity = 57/137 (41.61%), Postives = 85/137 (62.04%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K L  D P   S  P  +++  W A I GPP++P+  G F +T+ F   YP KPP V F +K+FHPNI +NG +CLDIL+ +WSP   ++ +L S+ SLL DPNP  P   + A ++K +  +YE
Sbjct:    2 STAAKRRLIRDFKRLTSDAPIGISGSPNPDNIMVWNAVIFGPPETPFEDGSFRLTLTFTDAYPNKPPTVRFISKMFHPNIYANGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNPASPANVDAAQLFKENLKEYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2C_DICDI (Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.656e-28
Identity = 62/145 (42.76%), Postives = 89/145 (61.38%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKS--------DKAKYEATAR 571
            SKR+  EL +L   P    SA P  +++F+W  TI G  D+ Y    F +++ FP DYP+KPP V F T+ FHPN+++NG+ICLDILK++WSP   +  +L+SI SLL +PN + PL    A ++ +        DK   EAT+R
Sbjct:    8 SKRLQSELMNLMMGPSPGISAFPDGDNIFNWIGTIQGAKDTVYEQMEFKMSLKFPTDYPYKPPTVKFETQCFHPNVDNNGNICLDILKDKWSPVYNVRSLLISIQSLLGEPNNESPLNSYAASLWSNQDEYKKVLDKRYQEATSR 152          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2T_BOVIN (Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN=UBE2T PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.775e-28
Identity = 59/148 (39.86%), Postives = 91/148 (61.49%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            + R+ +EL  L  +PP   +     + M   +A I+G  ++PY  GVF + +H P  YPF+PP++ F T ++HPNI+S G ICLD+L    K  W P+L I+ +L  I  L+ +PNPDDPL+ +I+  +K +K  +   AR WT+K+A
Sbjct:    4 TSRLKRELSLLAAEPPPGITCWQDGDRMEDLRAQILGGANTPYEKGVFKLEVHIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATLLTCIQQLMAEPNPDDPLMADISSEFKYNKPVFFKNARQWTEKHA 151          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC7_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC7 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.236e-28
Identity = 59/148 (39.86%), Postives = 88/148 (59.46%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            A KR+LKEL+ L KD P    AGP +E+ +F W   I GPPD+PYA GVF   + FP DYP  PPK+ F   + HPNI  NG +C+ IL             +E+WSP  ++ K+LLS+ S+L++PN +     +   +++ ++ ++E
Sbjct:    5 AQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFE 152          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2T_HUMAN (Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens GN=UBE2T PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.144e-28
Identity = 60/148 (40.54%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            + R+ +EL  L  +PP   +     + M   +A I+G  ++PY  GVF + +  P  YPF+PP++ F T ++HPNI+S G ICLD+L    K  W P+L I+ VL SI  L+++PNPDDPL+ +I+  +K +K  +   AR WT+K+A
Sbjct:    4 ASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHA 151          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC2_KLULA5.101e-3039.19Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces... [more]
UBC27_ARATH6.663e-3045.83Ubiquitin carrier protein E2 27 OS=Arabidopsis tha... [more]
UBE2K_MOUSE1.939e-2944.67Ubiquitin-conjugating enzyme E2 K OS=Mus musculus ... [more]
UBE2K_HUMAN1.939e-2944.67Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens ... [more]
UBE2K_BOVIN1.939e-2944.67Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN... [more]
UBC2_CRYNE2.532e-2941.61Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus ... [more]
UBE2C_DICDI3.656e-2842.76Probable ubiquitin-conjugating enzyme E2 C OS=Dict... [more]
UBE2T_BOVIN4.775e-2839.86Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN... [more]
UBC7_YEAST6.236e-2839.86Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]
UBE2T_HUMAN8.144e-2840.54Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top