BQ623021
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC22_ARATH (Ubiquitin carrier protein E2 22 OS=Arabidopsis thaliana GN=UBC22 PE=1 SV=1) HSP 1 Score: 47.3654 bits (111), Expect = 6.596e-11 Identity = 24/70 (34.29%), Postives = 39/70 (55.71%), Query Frame = 2 Query: 110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYA 319 N+ SNG IC++ LK+ W+P+L + VL + LL +P P+ L + M + +Y AR +T +A Sbjct: 86 NVASNGEICVNTLKKDWNPSLGLRHVLSVVRCLLIEPFPESALNEQAGKMLLENYDEYARHARLYTGIHA 155 HSP 2 Score: 39.2762 bits (90), Expect = 6.596e-11 Identity = 15/34 (44.12%), Postives = 21/34 (61.76%), Query Frame = 1 Query: 7 SPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108 +PY G+F + + D+P PPK F TK+FHP Sbjct: 52 TPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHP 85 The following BLAST results are available for this feature:
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 201
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623021 ID=BQ623021; Name=BQ623021; organism=Citrus sinensis; type=EST; length=526bpback to top |