BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C724B_ORYSJ (Cytochrome P450 724B1 OS=Oryza sativa subsp. japonica GN=CYP724B1 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.045e-25
Identity = 66/185 (35.68%), Postives = 95/185 (51.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            TTS  I+M    L Q      L+ +EH  I + K   E L+ ED KK++YT  V  E++R    +    RKA+ D+ Y+ + IP GWKVL      H NP    +   F P R+E         + PFGGGPRLC G +LAK+    F+H++V  Y W +   +  +    + F  +G+PI+I P
Sbjct:  292 TTSLLISMVVYFLGQSAQDLELVKREHEGIRSKKEKDEFLSSEDYKKMEYTQHVINEALRCGNIVKFVHRKALKDVRYKEYLIPSGWKVLPVFSAVHLNPLLHGNAQQFQPCRWEGASQGTSKKFTPFGGGPRLCPGSELAKVEAAFFLHHLVLNYRWRIDGDDIPMAYPYVEF-QRGLPIEIEP 475          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C90C1_ARATH (Cytochrome P450 90C1 OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3)

HSP 1 Score: 113.62 bits (283), Expect = 7.772e-25
Identity = 61/187 (32.62%), Postives = 103/187 (55.08%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNK-RAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            T   A+ +  K L+ +P   + L++E++ +   K   GE     D   + +T  V  E++R+   I G +RKA+ D+E +G+ IPKGW VL +    H + + +++P  FDP R++     +     + PFGGG RLC G +L+KL I IF+H++VTRY W+     + I   P     + +PI+++
Sbjct:  326 TMPTAMTLAVKFLSDNPVALAKLVEENMEMKRRKLELGEEYKWTDYMSLSFTQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWCVLASFISVHMDEDIYDNPYQFDPWRWDRINGSANSSICFTPFGGGQRLCPGLELSKLEISIFLHHLVTRYSWTA--EEDEIVSFPTVKMKRRLPIRVA 510          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C85A2_ARATH (Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CYP85A2 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 7.772e-25
Identity = 68/185 (36.76%), Postives = 97/185 (52.43%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVPPYVY-LPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            T S    M  K L  HP     L +EH+ I   KR  E LTL+D+K +K+T  V  E+ RL   + G  RK   D+E  G+ IPKGW++       + +   +EDP+ F+P R+ E+S+    Y L FGGG RLC G +L    +  F+HY VT+Y W   N  + + + P     +G  +K SP
Sbjct:  281 TVSTTSMMALKYLHDHPKALEELRREHLAIRERKRPDEPLTLDDIKSMKFTRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRIYVYTREINYDTSLYEDPMIFNPWRWMEKSLESKSYFLLFGGGVRLCPGKELGISEVSSFLHYFVTKYRWE-ENGEDKLMVFPRVSAPKGYHLKCSP 464          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C85A1_ARATH (Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 7.772e-25
Identity = 70/188 (37.23%), Postives = 95/188 (50.53%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            T S    M  K L  HP     L  EH+     KR  E L LED+K +K+T  V  E+ RL   + G  RK   D+E  G+ IPKGW++       + +   +EDPL F+P R+     E     +V   FGGG RLC G +L  + I  F+HY VTRY W  I  +E + + P  F  +G  ++ISP
Sbjct:  281 TVSTTSMMALKYLHDHPKALQELRAEHLAFRERKRQDEPLGLEDVKSMKFTRAVIYETSRLATIVNGVLRKTTRDLEINGYLIPKGWRIYVYTREINYDANLYEDPLIFNPWRWMKKSLESQNSCFV---FGGGTRLCPGKELGIVEISSFLHYFVTRYRWEEIGGDE-LMVFPRVFAPKGFHLRISP 464          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26A_XENLA (Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.326e-24
Identity = 61/190 (32.11%), Postives = 98/190 (51.58%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVN---IMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            TT+ A       LA H D    + +E      +       + L++E ++++KYT  V +E++RL PP+ G FR A+      G+ IPKGW V+++   TH   + F D   F+P RF   +P     + ++PFGGG R C G + AK+ + +FV  +    DW L+N + ++T  P+  P   +P K  P
Sbjct:  298 TTASAATSLTSFLALHKDVLEKVRKELETQGLLSTKPEEKKELSIEVLQQLKYTSCVIKETLRLSPPVAGGFRVALKTFVLNGYQIPKGWNVIYSIADTHGEADLFPDTDKFNPDRFLTPLPRDSSRFGFIPFGGGVRCCIGKEFAKILLKVFVVELCRNCDWELLNGSPAMTTSPIICPVDNLPAKFKP 487          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: KAO2_ARATH (Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 5.038e-24
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 1
Query:   34 MLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            ++ +HP       +E   I+  +  G+ LTL++ +++ Y  QV  E++R+      +FR+A SD++ +G+ IPKGWKVL      H +PE + DP  FDP R+E   P    +LPFG G  LC G  LAKL I IF+H+ + +Y     NP   +   P   P      +I+
Sbjct:  314 LMQEHPMILQKAKEEQERIVKKRAPGQKLTLKETREMVYLSQVIDETLRVITFSLTAFREAKSDVQMDGYIIPKGWKVLTWFRNVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKLEISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLARIT 485          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: KAO1_ARATH (Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.122e-23
Identity = 61/173 (35.26%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   37 LAQHPDCYSLLLQEHVNIMNNKRAGEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY--VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            L +HP+       E   I+ ++  G+  L+L++ +K+++  QV  E++R+      +FR+A +D+E  G+ IPKGWKVL      H +PE F DP  FDP R++    P    +LPFG G  LC G  LAKL I IF+H+ + +Y     NP   +   P   P+     +IS
Sbjct:  316 LQEHPEVLQRAKAEQEMILKSRPEGQKGLSLKETRKMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYLIPKGWKVLTWFRDVHIDPEVFPDPRKFDPARWDNGFVPKAGAFLPFGAGSHLCPGNDLAKLEISIFLHHFLLKYQVKRSNPECPVMYLPHTRPTDNCLARIS 488          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: KAO1_HORVU (Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.500e-23
Identity = 65/172 (37.79%), Postives = 90/172 (52.33%), Query Frame = 1
Query:   37 LAQHPDCYSLLLQEHVNIMNNKRAGEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            L ++P+  +    E   IM +   G+  LTL D +K+ Y  QV  E++R     F SFR+A  D+   G+ IPKGWKV       H +P+ + DP  FDP R+E   P    +LPFG G RLC G  LAKL I +F+H+ +  Y  +  NPN  +   P P P      KI+
Sbjct:  321 LQENPEILAKAKAEQEAIMRSIPPGQKGLTLRDFRKMAYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLIPKGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEISVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLAKIT 492          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26A_CHICK (Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.500e-23
Identity = 59/186 (31.72%), Postives = 96/186 (51.61%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHV--NIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPP----YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIK 540
            TT+ A       L  H D    + +E     +++     + L +E ++++KYT  V +E++RL PP+ G FR A+  +E  G+ IPKGW V+++   TH   + F D   F+P RF    P     + ++PFGGG R C G + AK+ + IF   +    DW L+N   ++   P+ +P   +P K
Sbjct:  299 TTASAATSLIAFLGLHHDVLQKVRKELQLKGLLSGPNQEKQLNMEFLEQLKYTGCVIKETLRLSPPVPGGFRIALKTLELNGYQIPKGWNVIYSICDTHDVADLFTDKDEFNPDRFMSPSPEDSSRFSFIPFGGGLRSCVGKEFAKVLLKIFTVELARSCDWQLLNGPPTMKTGPIVYPVDNLPAK 484          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C88A1_MAIZE (Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.265e-23
Identity = 64/172 (37.21%), Postives = 91/172 (52.91%), Query Frame = 1
Query:   37 LAQHPDCYSLLLQEHVNIMNNKRAGEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            L ++PD ++    E   IM +  + +  LTL D +K++Y  QV  E++RL    F SFR+A  D+   G+ IPKGWKV       H +P+ + DP  FDP R+E   P    +L FG G RLC G  LAKL I +F+H+ +  Y  +  NP   +   P P P      KI+
Sbjct:  344 LQENPDMFARAKAEQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIPKGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFLAFGLGARLCPGNDLAKLEISVFLHHFLLGYKLARTNPRCRVRYLPHPRPVDNCLAKIT 515          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C724B_ORYSJ2.045e-2535.68Cytochrome P450 724B1 OS=Oryza sativa subsp. japon... [more]
C90C1_ARATH7.772e-2532.62Cytochrome P450 90C1 OS=Arabidopsis thaliana GN=RO... [more]
C85A2_ARATH7.772e-2536.76Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CY... [more]
C85A1_ARATH7.772e-2537.23Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CY... [more]
CP26A_XENLA1.326e-2432.11Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 ... [more]
KAO2_ARATH5.038e-2434.88Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thalia... [more]
KAO1_ARATH1.122e-2335.26Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thalia... [more]
KAO1_HORVU2.500e-2337.79Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN... [more]
CP26A_CHICK2.500e-2331.72Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 P... [more]
C88A1_MAIZE4.265e-2337.21Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top