BQ623097

Overview
NameBQ623097
Unique NameBQ623097
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8 contig Csv1_Contig8:1..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL37_ARATH (GDSL esterase/lipase At2g19060 OS=Arabidopsis thaliana GN=At2g19060 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.429e-23
Identity = 71/236 (30.08%), Postives = 120/236 (50.85%), Query Frame = 2
Query:   29 TGVSFASGGAGYDPLTSK-VASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTY-LSTPFRRGQ-YDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSK--EFPDSRFVYFDIYNPLNSLIQNPPQY---GFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            TG+++ASGGAG    TS+ +   +S   Q+   +K +     TAG       L K L+ +  GS+D  N Y +  P+   + +  + Y D    S  S+L+ LY +GAR++ V  +  +GC P     +GG  +GC+   N+A + +N KL+ ++   ++      ++F + D+++      QNP +Y   GF V DK CC   +  G  LC    +   CP+  +Y++WD+ H T
Sbjct:  103 TGINYASGGAGLLEETSQHLGERISFEKQITNHRKMI----MTAG--VPPEKLKKCLYTINIGSNDYLNNYFMPAPYTTNENFSFDEYADFLIQSYRSYLKSLYVLGARKVAVFGVSKLGCTPRMIASHGG-GKGCATEVNKAVEPFNKKLKDLISEFNRISVVDHAKFTFVDLFSS-----QNPIEYFILGFTVTDKSCCTVES--GQELC--AANKPVCPNRERYVYWDNVHST 322          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL36_ARATH (GDSL esterase/lipase At2g19050 OS=Arabidopsis thaliana GN=At2g19050 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.429e-23
Identity = 70/239 (29.29%), Postives = 119/239 (49.79%), Query Frame = 2
Query:   14 PQDLVTGVSFASGGAGYDPLTSK-VASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTY-LSTPFRRGQ-YDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQY---GFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            P+    G+++ASGG G    TS+ +   +S   Q+   +  + T K    +      L+K L+ +  GS+D  N Y +  P+   + +  + Y D    S  S+L+ LY +GAR++ V  +  +GC P     +GG   GC+   N+A + +N  L+++V   +++F D++F + DI++      Q+P  +   GF V DK CC      G  LC   E    CP   +Y++WD+ H T
Sbjct:   99 PEQAHIGINYASGGGGIREETSQHLGEIISFKKQIKNHRSMIMTAKVPEEK------LNKCLYTINIGSNDYLNNYFMPAPYMTNKKFSFDEYADSLIRSYRSYLKSLYVLGARKVAVFGVSKLGCTPRMIASHGG-GNGCAAEVNKAVEPFNKNLKALVYEFNRDFADAKFTFVDIFSG-----QSPFAFFMLGFRVTDKSCCTV--KPGEELCATNE--PVCPVQRRYVYWDNVHST 321          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GLIP1_ARATH (GDSL esterase/lipase 1 OS=Arabidopsis thaliana GN=GLIP1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.479e-23
Identity = 63/247 (25.51%), Postives = 112/247 (45.34%), Query Frame = 2
Query:    2 PNLKP----QDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILC----NRLEDAATCPDASKYIFWDSYHPTGK 718
            PNL+P         GV+FASGGAG    T      +++  QL+ FKK  E +++  G+     ++S+ +++   G +D    + +            Y D    +     +E+Y +G R+ G+L+  P  C P    ++    R C     +   ++N KL + +  L+ E    ++   D +  L+  + +P +YGF+   K CCG+G L G   C       +    C + + Y+F+D +H T K
Sbjct:  100 PNLQPFNGNSQFAYGVNFASGGAGALVGTFS-GLVINLRTQLNNFKKVEEMLRSKLGDAEGKRVISRAVYLFHIGLNDYQYPFTTNSSLFQSISNEKYVDYVVGNMTDVFKEVYNLGGRKFGILNTGPYDCAPASLVIDQTKIRSCFQPVTELINMHNEKLLNGLRRLNHELSGFKYALHDYHTSLSERMNDPSKYGFKEGKKACCGSGPLRGINTCGGRMGLSQSYELCENVTDYLFFDPFHLTEK 345          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GLIP3_ARATH (GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=GLIP3 PE=2 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 8.447e-22
Identity = 64/247 (25.91%), Postives = 115/247 (46.56%), Query Frame = 2
Query:    2 PNLKPQD----LVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILC-NRL---EDAATCPDASKYIFWDSYHPTGK 718
            PNL+P +       GVSFAS GAG     S +   +++  QL+ FK   +++++  G+  T  + S+ +++   G++D    + +            + D    +    ++E+Y +G R+ G L++ P  C P     +      C     +   ++N K   V+  L ++    R+   D +  L+  I +P +YGF+   K CCG+G L G   C NR+   +    C + + Y+F+DS H T K
Sbjct:   91 PNLQPNNGNNQFTYGVSFASAGAGA-LAESFLGMVINLGTQLNNFKDVEKSLRSELGDAETKRVFSRAVYLFHIGANDYFYPFSANSSTFKSNSKEKFVDFVIGNITFVIEEVYKMGGRKFGFLNVGPYECSPNSLIRDRTKIGSCFKPVAELIDMHNKKFPDVLRRLQRQLSGFRYALHDYHTSLSERINSPSKYGFKEGKKACCGSGPLRGINTCGNRIGPSQGYGLCENVTDYLFYDSSHLTEK 336          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GLIP2_ARATH (GDSL esterase/lipase 2 OS=Arabidopsis thaliana GN=GLIP2 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.882e-21
Identity = 63/235 (26.81%), Postives = 111/235 (47.23%), Query Frame = 2
Query:   32 GVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYL--STPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNR----LEDAATCPDASKYIFWDSYHPTGK 718
            GVSFAS GAG    T      +++  QL+ FKK  + +++T GE     ++S+ +++   G +D    +   S+ F+    +I  Y D    +  + ++E+Y +G R+ G L++    C P    ++      C     +   ++N KL+S +  L +E    ++   D +  L+  + NP +YGF+     CCGTG L G   C       +    C   + Y+F+D +H T K
Sbjct:  116 GVSFASAGAGALVGTFP-GMVINLKSQLNNFKKVEKLLRSTLGEAQGKMVISRAVYLFHIGVNDYQYPFSTNSSIFQSSPQEI--YVDFVVGNTTAVIKEVYKIGGRKFGFLNMGAYDCAPASLIIDQTKIGTCFKPVTELINLHNEKLESGLRRLERELSGFKYALHDYHTSLSVRMNNPSKYGFKEGKMACCGTGPLRGINTCGGRMGVSQSYELCEKVTDYLFFDHFHLTEK 347          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL68_ARATH (GDSL esterase/lipase At4g30140 OS=Arabidopsis thaliana GN=At4g30140 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.717e-20
Identity = 67/230 (29.13%), Postives = 113/230 (49.13%), Query Frame = 2
Query:   32 GVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTP--FRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVP-VQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            G+++ASG  G    TS+     +M +++ L ++      A        + L + L+ +  GS+D  N Y  +P    R  ++ + Y     S    +L +LY +GAR + +  +  IGC P +  TL GG   GC++  NQA  I+N+KL+++V   + + P + F Y D+++      ++    G  V D+ CC      G  LC    +   CPD +K+IFWD+ H T
Sbjct:  107 GLNYASGAGGIREETSE-----NMGERISLRQQVNNHFSAIITAAVPLSRLRQCLYTINIGSNDYLNNYFLSPPTLARRLFNPDQYARSLISLYRIYLTQLYVLGARNVALFGIGKIGCTPRIVATLGGGT--GCAEEVNQAVIIFNTKLKALVTDFNNK-PGAMFTYVDLFS---GNAEDFAALGITVGDRSCCTVN--PGEELC--AANGPVCPDRNKFIFWDNVHTT 321          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL35_ARATH (GDSL esterase/lipase At2g19010 OS=Arabidopsis thaliana GN=At2g19010 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.300e-19
Identity = 68/240 (28.33%), Postives = 116/240 (48.33%), Query Frame = 2
Query:   14 PQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTY-LSTPFR-RGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVP-VQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQ----YGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            P+   TG+++ASGG+G    TS+      + D++ + K+      +       A  L + L+M+  GS+D  N Y +S P+  + +Y    Y         S L+ L+ +GAR++ V  L  IGC P + ++ + G  + CS   N+A +I+N  L  +V   +K+   ++F Y D+++         PQ     GF+V  K CC      G  LC  + +   C + ++Y+FWD  H T
Sbjct:   94 PEQAHTGMNYASGGSGLREETSE-----HLGDRISIRKQLQNHKTSITKANVPAERLQQCLYMINIGSNDYINNYFMSKPYNTKRRYTPKQYAYSLIIIYRSHLKNLHRLGARKVAVFGLSQIGCTPKIMKSHSDG--KICSREVNEAVKIFNKNLDDLVMDFNKKVRGAKFTYVDLFS------GGDPQAFIFLGFKVGGKSCCTVN--PGEELC--VPNQPVCANRTEYVFWDDLHST 316          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL32_ARATH (GDSL esterase/lipase At2g03980 OS=Arabidopsis thaliana GN=At2g03980 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.665e-18
Identity = 64/235 (27.23%), Postives = 117/235 (49.79%), Query Frame = 2
Query:   29 TGVSFASGGAGYDPLTSK-VASALSMSDQLDLFKKAL-ETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVP--VQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLI-QNPPQYGFEVAD--KGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            TG+++AS G G  P T + + + LS+S Q+D+F++ +   +K    +      L++ LFM+  G +D    +  T       D N + +      L  ++ L+ +GAR+  + ++ P+GC P  V +T+  G    C+D  N A  I+N+KL+  +  ++++F  + F+Y D YN +  L   +  Q G  + +    CC     +G  L +    +  C     +IF+D +HPT
Sbjct:  119 TGINYASAGCGILPQTGRQIGTCLSLSVQVDMFQETITNNLKKNFKKSELREHLAESLFMIAIGVNDYTFLFNETT------DANEFANKLLHDYLLQIERLHKLGARKFFINNIKPLGCYPNVVAKTVPRG---SCNDALNFAVSIFNTKLRKSLSRMTQKFIKTSFLYSDYYNYMLGLRGPSSNQVGSSLLNVTSPCC-PNVYDGGQLTSCKPGSIACKAPDTHIFFDPFHPT 343          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL49_ARATH (GDSL esterase/lipase At3g05180 OS=Arabidopsis thaliana GN=At3g05180 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.673e-17
Identity = 57/192 (29.69%), Postives = 93/192 (48.44%), Query Frame = 2
Query:  185 SKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIAR-----GCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTG----NLEGSILCNR-------LEDAATCPDASKYIFWDSYHPT 712
            S GL+M   G +DIA  + +    +    +    D+        ++ LY  GAR   + +  P+GC+    ++ G         GC    NQAA+++N +L  +   L +++P+SRF Y DI++  + LI N  +YGF+ +   CCGTG    N +  + C +       +  A  C D+SKY+ WD  H T
Sbjct:  167 SNGLYMFDIGQNDIAGAFYTKTVDQVLALVPIILDIFQDG----IKRLYAEGARNYWIHNTGPLGCLAQVVSIFGEDKSKLDEFGCVSDHNQAAKLFNLQLHGLFKKLPQQYPNSRFTYVDIFSIKSDLILNHSKYGFDHSIMVCCGTGGPPLNYDDQVGCGKTARSNGTIITAKPCYDSSKYVNWDGIHYT 354          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL21_ARATH (GDSL esterase/lipase At1g54030 OS=Arabidopsis thaliana GN=At1g54030 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.060e-16
Identity = 44/176 (25.00%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  185 SKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            S+ ++++  GSDD  +   S P         ++ D   ++  + ++ +YG G R+    +L P+GC+P  +  +G +   C    ++ A ++N KL  ++  LS+E    ++ ++D ++ + + +     Y FE  +  CCGTG++ GS           C    +YIF+D  H T
Sbjct:  164 SEAIYLIYIGSDDYLSYAKSNP-SPSDTQKQAFVDQVITTIKAEIKVVYGSGGRKFAFQNLAPLGCLPAVKQASGNVQE-CVKLPSEMAALHNKKLLQLLVELSRELNGFQYSFYDFFSSIQNRVIKSKTYTFETGNAACCGTGSINGS----NCSAKNVCAKPEEYIFFDGKHLT 333          
The following BLAST results are available for this feature:
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
GDL37_ARATH3.429e-2330.08GDSL esterase/lipase At2g19060 OS=Arabidopsis thal... [more]
GDL36_ARATH3.429e-2329.29GDSL esterase/lipase At2g19050 OS=Arabidopsis thal... [more]
GLIP1_ARATH4.479e-2325.51GDSL esterase/lipase 1 OS=Arabidopsis thaliana GN=... [more]
GLIP3_ARATH8.447e-2225.91GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=... [more]
GLIP2_ARATH1.882e-2126.81GDSL esterase/lipase 2 OS=Arabidopsis thaliana GN=... [more]
GDL68_ARATH2.717e-2029.13GDSL esterase/lipase At4g30140 OS=Arabidopsis thal... [more]
GDL35_ARATH2.300e-1928.33GDSL esterase/lipase At2g19010 OS=Arabidopsis thal... [more]
GDL32_ARATH9.665e-1827.23GDSL esterase/lipase At2g03980 OS=Arabidopsis thal... [more]
GDL49_ARATH3.673e-1729.69GDSL esterase/lipase At3g05180 OS=Arabidopsis thal... [more]
GDL21_ARATH4.060e-1625.00GDSL esterase/lipase At1g54030 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00188 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00188 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623097 ID=BQ623097|Name=BQ623097|organism=Citrus sinensis|type=EST|length=719bp
TCCAAATCTAAAGCCTCAAGACCTTGTTACTGGCGTAAGTTTTGCCTCAG
GTGGAGCTGGATATGATCCTCTTACATCAAAAGTAGCGTCTGCGTTATCA
ATGTCGGATCAATTGGACTTGTTCAAGAAAGCATTAGAGACAATAAAAGC
TACAGCGGGAGAAGAAGCAACTGCAAATATACTATCAAAAGGCTTATTCA
TGGTGGTCTCCGGAAGTGATGATATTGCAAATACTTATTTATCAACTCCA
TTCAGGAGAGGCCAATATGATATCAATTCCTATACTGATTTAACAGCTAG
TTCAGCTTTAAGTTTCTTACAGGAACTGTATGGAGTTGGAGCAAGGAGAA
TAGGAGTACTTAGTTTACCACCAATTGGGTGTGTGCCAGTACAGAGAACA
CTCAATGGGGGCATCGCTAGAGGCTGTTCAGATTTTGCCAATCAAGCTGC
TCAAATCTACAACTCGAAGCTCCAATCTGTAGTTGATTCTCTCAGTAAAG
AGTTTCCAGATTCAAGATTTGTCTACTTTGATATCTACAATCCACTGAAT
TCTCTTATCCAAAACCCTCCTCAATATGGGTTTGAAGTGGCAGATAAAGG
GTGCTGCGGCACTGGAAATTTAGAGGGTAGCATACTGTGCAATCGTTTGG
AGGATGCAGCGACATGCCCGGATGCATCCAAATACATATTCTGGGACAGT
TACCATCCCACGGGAAAGG
back to top