BQ623110
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 3.220e-13 Identity = 37/62 (59.68%), Postives = 45/62 (72.58%), Query Frame = 2 Query: 311 AFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFV-QAIVTGKGPIENLYDHIADPVANN 493 AFDPLG + DP +F ELK+KE+KNGRLAM + GF V Q+ G GP+ENL H+ADP NN Sbjct: 171 AFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 232
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 3.220e-13 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 2 Query: 311 AFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFV-QAIVTGKGPIENLYDHIADPVANN 493 AFDPLG + DP +F ELKVKE+KNGRLA+ ++ GF V Q+ G GP+ENL H+ADP NN Sbjct: 172 AFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNN 233
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.036e-11 Identity = 31/57 (54.39%), Postives = 43/57 (75.44%), Query Frame = 2 Query: 314 FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPV 484 FDPLGLA DP++ A+L++ E+K+ RLAM + GF VQA TGKGP+ N H++DP+ Sbjct: 223 FDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPL 279
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 2 Query: 314 FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPV 484 FDPLGLA DP + A+L++ E+K+ RLAM GF VQA TGKGP+ N H++DP+ Sbjct: 220 FDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPL 276 The following BLAST results are available for this feature:
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 74
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623110 ID=BQ623110; Name=BQ623110; organism=Citrus sinensis; type=EST; length=623bpback to top |