BQ623120

Overview
NameBQ623120
Unique NameBQ623120
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length585
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623120_ssr399 microsatellite BQ623120_ssr399:399..410. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2668 contig Csv1_Contig2668:219..802. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTP2_TOBAC (Non-specific lipid-transfer protein 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.757e-24
Identity = 53/97 (54.64%), Postives = 68/97 (70.10%), Query Frame = 1
Query:   58 PVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            P   A++CGQV   LAPC+ +L+  GR P   CC GV+ L GAA++  DR+ AC CLK A  +I GI+   AAGLP  CGV+IPYKISP+TDCS+V+
Sbjct:   20 PHAEALSCGQVQSGLAPCLPYLQ--GRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ 114          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLT43_HORVU (Non-specific lipid-transfer protein 4.3 OS=Hordeum vulgare GN=LTP4.3 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.757e-24
Identity = 50/93 (53.76%), Postives = 68/93 (73.12%), Query Frame = 1
Query:   70 AITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            AI+CGQV+ +L+PCI++ R  G  PP  CC+GV+ L GAA++T D+QAAC C+K A     G+NA  AAG+P  CGVS+PY IS + DCS++R
Sbjct:   26 AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSA---AGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLT42_HORVU (Non-specific lipid-transfer protein 4.2 OS=Hordeum vulgare GN=LTP4.2 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.757e-24
Identity = 50/93 (53.76%), Postives = 68/93 (73.12%), Query Frame = 1
Query:   70 AITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            AI+CGQV+ +L+PCI++ R  G  PP  CC+GV+ L GAA++T D+QAAC C+K A     G+NA  AAG+P  CGVS+PY IS + DCS++R
Sbjct:   26 AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSA---AGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.600e-24
Identity = 55/99 (55.56%), Postives = 69/99 (69.70%), Query Frame = 1
Query:   58 PVTN--AITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            P+T+  A++CG V+G +APCI +L   G  P   CC GV +LN  ARTTPDRQ AC CL  A  S P +NA  AAGLP+ CGV+IPYKIS +T+C+ VR
Sbjct:   20 PITSNAALSCGTVSGYVAPCIGYLTQNGPLPRG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTP1_LENCU (Non-specific lipid-transfer protein 1 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 6.141e-24
Identity = 51/93 (54.84%), Postives = 67/93 (72.04%), Query Frame = 1
Query:   70 AITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            AI+CG V+G+L PC+ +L+ GG  P P CC GV+ LNGAARTT DR+AACNCLK +  SI G+     A LP +CGV +PY IS +T+C+ +R
Sbjct:   26 AISCGTVSGALVPCLTYLK-GGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIR 117          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTPA_BRAOT (Non-specific lipid-transfer protein A OS=Brassica oleracea var. italica GN=WAX9A PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 8.021e-24
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:   58 PVT--NAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSI-PGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            P+T   A+TCG V  ++APCI ++  GG  P   CC GV  LN  ARTTPDRQ AC CL+ A R++ P +NA  AAG+P+ CGVS+P+ IS NT+C+ V+
Sbjct:   20 PITANRALTCGTVNSNVAPCIGYITQGGTLPGA-CCTGVSKLNSMARTTPDRQQACRCLETAARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNVK 118          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLPN (Non-specific lipid-transfer protein 2 OS=Solanum pennellii GN=LTP2 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 8.021e-24
Identity = 53/97 (54.64%), Postives = 65/97 (67.01%), Query Frame = 1
Query:   58 PVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            P   A+TCGQVT +LAPC+ +L   G  P   CC GV+ L G A+TT DRQ AC CLK A  S  G++   AA LP  C V+IPYKISP+TDCS+V+
Sbjct:   20 PHAEALTCGQVTSTLAPCLPYLMNRG--PLGGCCGGVKGLLGQAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKVQ 114          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTPB_BRAOT (Non-specific lipid-transfer protein B OS=Brassica oleracea var. italica GN=WAX9B PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.368e-23
Identity = 53/93 (56.99%), Postives = 65/93 (69.89%), Query Frame = 1
Query:   70 AITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 348
            A++CG V+G+LA CI +L   G  P   CC GV +LN  ARTTPDRQ AC CL  A  S P +NA  AAGLP+ CGV+IPYKIS +T+C+ VR
Sbjct:   26 ALSCGTVSGNLAACIGYLTQNGPLPRG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTP5_VITSX (Non-specific lipid-transfer protein P5 OS=Vitis sp. PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.368e-23
Identity = 50/91 (54.95%), Postives = 66/91 (72.53%), Query Frame = 1
Query:   73 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRV 345
            ++CG V   LAPCI +LR+ G  P   CCNGV++L  +A TT DR+ AC CL  A +SI G+N  +AAGLP +CGV+IPYKISP+T+C +V
Sbjct:    1 LSCGDVATQLAPCINYLRSAGPLPVA-CCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV 90          
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 1.787e-23
Identity = 52/91 (57.14%), Postives = 63/91 (69.23%), Query Frame = 1
Query:   73 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRV 345
            ITCG V+  LAPCI +L+ G       CC G+++LN AA TTPDR+ ACNCLK A  +I GIN   AAGLP  CGV IPY ISP+T+C+ V
Sbjct:   28 ITCGMVSSKLAPCIGYLKGGPL--GGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
The following BLAST results are available for this feature:
BLAST of BQ623120 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP2_TOBAC2.757e-2454.64Non-specific lipid-transfer protein 2 OS=Nicotiana... [more]
NLT43_HORVU2.757e-2453.76Non-specific lipid-transfer protein 4.3 OS=Hordeum... [more]
NLT42_HORVU2.757e-2453.76Non-specific lipid-transfer protein 4.2 OS=Hordeum... [more]
NLTP2_BRANA3.600e-2455.56Non-specific lipid-transfer protein 2 OS=Brassica ... [more]
NLTP1_LENCU6.141e-2454.84Non-specific lipid-transfer protein 1 OS=Lens culi... [more]
NLTPA_BRAOT8.021e-2452.00Non-specific lipid-transfer protein A OS=Brassica ... [more]
NLTP2_SOLPN8.021e-2454.64Non-specific lipid-transfer protein 2 OS=Solanum p... [more]
NLTPB_BRAOT1.368e-2356.99Non-specific lipid-transfer protein B OS=Brassica ... [more]
NLTP5_VITSX1.368e-2354.95Non-specific lipid-transfer protein P5 OS=Vitis sp... [more]
NLTP_SPIOL1.787e-2357.14Non-specific lipid-transfer protein OS=Spinacia ol... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00211 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00211 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623120 ID=BQ623120|Name=BQ623120|organism=Citrus sinensis|type=EST|length=585bp
CTCATGGCTGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGT
GACTGCCCCAGTGACTAATGCCATAACATGTGGGCAGGTGACAGGCTCCT
TGGCTCCATGCATCGCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCC
CCATGCTGTAACGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCC
TGACCGCCAAGCTGCATGCAACTGCTTGAAGCAAGCTTACCGATCAATCC
CCGGCATCAACGCTAATGTTGCCGCTGGCCTTCCTCGTCAATGTGGAGTC
AGCATTCCTTACAAGATCAGCCCCAACACTGACTGCTCTAGGGTCAGGTG
AAGTTGAGTTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAAGAA
TAAATAAATAAAGAATATATATGTTAAATTTCTTTGTCCGAACGAGTCTC
CACTTGTGTGAGTCTCACTCTCATGTCATGTTTGTATCTTTGCTTTTAAT
ATCATATTAAATATGTAAACGTGATCTGTGTTTTGAGTGATTAATTCTAG
TTATTTTGGGGGATAAAAAAAAAAAAAAAAAACAA
back to top