BQ623152
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623152 vs. ExPASy Swiss-Prot
Match: IAA3_ARATH (Auxin-responsive protein IAA3 OS=Arabidopsis thaliana GN=IAA3 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 4.499e-12 Identity = 31/43 (72.09%), Postives = 37/43 (86.05%), Query Frame = 3 Query: 6 SDYVLTYEDKEGDWMLVGDVPWGMFLGSVKRLRIMRTSEATGL 134 SD+V TYEDK+GDWML+GDVPW MF+ + KRLRIM+ SEA GL Sbjct: 143 SDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGL 185
BLAST of BQ623152 vs. ExPASy Swiss-Prot
Match: AX22E_PHAAU (Auxin-induced protein 22E OS=Phaseolus aureus GN=AUX22E PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 4.499e-12 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 3 Query: 6 SDYVLTYEDKEGDWMLVGDVPWGMFLGSVKRLRIMRTSEATGL 134 S+Y TYEDK+GDWMLVGDVPW MF+ S KRLRI++ SEA GL Sbjct: 158 SEYAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIIKGSEAKGL 200
BLAST of BQ623152 vs. ExPASy Swiss-Prot
Match: IAA4_PEA (Auxin-induced protein IAA4 OS=Pisum sativum GN=IAA4/5 PE=1 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 7.674e-12 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 3 Query: 6 SDYVLTYEDKEGDWMLVGDVPWGMFLGSVKRLRIMRTSEATGL 134 S+Y TYEDK+GDWMLVGDVPW MF+ S KRLRIM+ +EA GL Sbjct: 143 SEYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEAKGL 185
BLAST of BQ623152 vs. ExPASy Swiss-Prot
Match: IAA8_ARATH (Auxin-responsive protein IAA8 OS=Arabidopsis thaliana GN=IAA8 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.002e-11 Identity = 30/56 (53.57%), Postives = 46/56 (82.14%), Query Frame = 3 Query: 6 SDYVLTYEDKEGDWMLVGDVPWGMFLGSVKRLRIMRTSEATGLAP-RLQESNGRQR 170 S++VLTYEDK+GDWMLVGDVPW +F + ++L+IM+ S++ GLAP +++S ++R Sbjct: 265 SEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKER 320
BLAST of BQ623152 vs. ExPASy Swiss-Prot
Match: IAA18_ARATH (Auxin-responsive protein IAA18 OS=Arabidopsis thaliana GN=IAA18 PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 6.496e-11 Identity = 32/53 (60.38%), Postives = 40/53 (75.47%), Query Frame = 3 Query: 9 DYVLTYEDKEGDWMLVGDVPWGMFLGSVKRLRIMRTSEATGLAPRLQESNGRQ 167 +Y LTYED EGD MLVGDVPW MF+ SVKRLR+++TSE ++ L NG+Q Sbjct: 213 EYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSE---ISSALTYGNGKQ 262 The following BLAST results are available for this feature:
BLAST of BQ623152 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 35
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623152 ID=BQ623152; Name=BQ623152; organism=Citrus sinensis; type=EST; length=487bpback to top |