BQ623332
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623332 vs. ExPASy Swiss-Prot
Match: CB2_DUNSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella salina PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.529e-14 Identity = 34/45 (75.56%), Postives = 38/45 (84.44%), Query Frame = 1 Query: 1 LAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVP 135 LAMF+ GFFVQAIVTGKGP+ENL DHLA+P NNA+AYAT F P Sbjct: 228 LAMFACLGFFVQAIVTGKGPIENLTDHLANPAENNAFAYATKFTP 272
BLAST of BQ623332 vs. ExPASy Swiss-Prot
Match: CB2_CHLRE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas reinhardtii GN=cabII-1 PE=3 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.772e-13 Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 1 Query: 1 LAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVP 135 LA FSMFGFFVQAIVTGKGP++NL DHLA+P NNA+A+AT F P Sbjct: 207 LASFSMFGFFVQAIVTGKGPVQNLDDHLANPTVNNAFAFATKFTP 251
BLAST of BQ623332 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 8.067e-13 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 1 LAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 138 LAMFS GFFVQAIVTGKGP++NL DHLADP N A+A AT F PG Sbjct: 207 LAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVNKAFASATKFTPG 252
BLAST of BQ623332 vs. ExPASy Swiss-Prot
Match: CB2_MALDO (Chlorophyll a-b binding protein AB10, chloroplastic OS=Malus domestica PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.919e-12 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 1 LAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 138 LAMFSMFGFFVQAIV+ K LENLADHL VNNNA + TNFVPG Sbjct: 222 LAMFSMFGFFVQAIVSRKDRLENLADHLGWTVNNNALSNVTNFVPG 267 The following BLAST results are available for this feature:
BLAST of BQ623332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 64
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623332 ID=BQ623332; Name=BQ623332; organism=Citrus sinensis; type=EST; length=356bpback to top |