BQ623426
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623426 vs. ExPASy Swiss-Prot
Match: UBC12_ASHGO (NEDD8-conjugating enzyme UBC12 OS=Ashbya gossypii GN=UBC12 PE=3 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 1.158e-11 Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 1 Query: 286 MGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDP 513 + P + Y GG F ++ F YP +PP V ++HPNI+ +G+ICL++L+E WSP + + V+L + L +P Sbjct: 65 ISPEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEP 140
BLAST of BQ623426 vs. ExPASy Swiss-Prot
Match: UBC12_YEAST (NEDD8-conjugating enzyme UBC12 OS=Saccharomyces cerevisiae GN=UBC12 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.513e-11 Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 1 Query: 283 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDP 513 I+ P + Y G + F YP +PPKV K+FHPNI+ G++CL+IL+E WSPAL + ++ + L +P Sbjct: 67 IVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEP 143
BLAST of BQ623426 vs. ExPASy Swiss-Prot
Match: UBC12_KLULA (NEDD8-conjugating enzyme UBC12 OS=Kluyveromyces lactis GN=UBC12 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.513e-11 Identity = 27/74 (36.49%), Postives = 45/74 (60.81%), Query Frame = 1 Query: 292 PSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDP 513 P YAGG + + YP +PP V +++HPNI+ +G++CL++L+E W+PAL I +++ I L +P Sbjct: 67 PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDIQSIIIGILFLFHEP 140 The following BLAST results are available for this feature:
BLAST of BQ623426 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 263
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623426 ID=BQ623426; Name=BQ623426; organism=Citrus sinensis; type=EST; length=576bpback to top |