BQ623527
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: TRXX_ARATH (Thioredoxin-X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 2.068e-13 Identity = 30/83 (36.14%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 149 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEK 397 + + ++ + S VL+S PVLVEF A WCGPC++I+P ++ LS++Y KL K++ D +P + + + +P ++FK+G++ Sbjct: 71 IKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFKDGKE 153
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO2_ANASP (Thioredoxin-2 OS=Anabaena sp. (strain PCC 7120) GN=trxB PE=1 SV=3) HSP 1 Score: 75.485 bits (184), Expect = 2.068e-13 Identity = 32/91 (35.16%), Postives = 55/91 (60.44%), Query Frame = 2 Query: 149 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVDWVL 421 V +TDA ++S VL + PVLV FWA WCGPC+++ P+I+ + Y +LK K+ D +P+ +Y + +P + + K + D+ + V+ Sbjct: 5 VITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVI 95
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO2_SYNY3 (Thioredoxin-like protein slr1139 OS=Synechocystis sp. (strain PCC 6803) GN=slr1139 PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 3.527e-13 Identity = 31/79 (39.24%), Postives = 46/79 (58.23%), Query Frame = 2 Query: 158 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGE 394 +TDA ++ PVLV FWA WCGPCR++ P I ++K Y KLK K+ D +P+ + + +P + +FKN E Sbjct: 6 ITDAEFEQETQGQTKPVLVYFWASWCGPCRLMAPAIQAIAKDYGDKLKVLKLEVDPNPAAVAQCKVEGVPALRLFKNNE 84
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO_PENCH (Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.985e-12 Identity = 32/86 (37.21%), Postives = 54/86 (62.79%), Query Frame = 2 Query: 152 PAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTV 409 P + A ++ V D+ PV+V+F A WCGPC+ I P +++LS+ + G ++ YKV+ DE +A G+ ++PT +K GE+ + V Sbjct: 5 PIKSVAEYKEKVTDATGPVVVDFHATWCGPCKAIAPALEKLSETHTG-IQFYKVDVDELSEVAASNGVSAMPTFHFYKGGERNEEV 89
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO_CHLCV (Thioredoxin OS=Chlamydophila caviae GN=trxA PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.985e-12 Identity = 30/68 (44.12%), Postives = 50/68 (73.53%), Query Frame = 2 Query: 206 VLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTV 409 VL++F+A WCGPC+M+ P+++ L + V + KVN D+ P+ A +YG+ SIPT+++FK+G++ D V Sbjct: 19 VLIDFFAEWCGPCKMLTPVLESLEAE-VSSVLIGKVNIDDHPAPAEQYGVSSIPTLILFKDGKEVDRV 85
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO_BORBU (Thioredoxin OS=Borrelia burgdorferi GN=trxA PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.899e-12 Identity = 28/73 (38.36%), Postives = 52/73 (71.23%), Query Frame = 2 Query: 203 PVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK-NGEKKDTVDWV 418 P +++F+A WCGPC+M+ PI ++LSK+Y + YKV+TD+ I++ G++S+PT++ +G+ K +V ++ Sbjct: 30 PAIIDFYANWCGPCKMLSPIFEKLSKKYENSIDFYKVDTDKEQDISSAIGVQSLPTILFIPVDGKPKVSVGFL 102
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO2_DROYA (Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.899e-12 Identity = 33/68 (48.53%), Postives = 43/68 (63.24%), Query Frame = 2 Query: 194 SGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEK 397 SG V+++F+A WCGPC+MI P + ELS QY + KV+ DE IA Y I S+PT + KNG K Sbjct: 19 SGKLVVLDFFATWCGPCKMISPKLAELSTQYADTVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVK 86
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO2_CAEEL (Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=2 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 3.899e-12 Identity = 34/84 (40.48%), Postives = 51/84 (60.71%), Query Frame = 2 Query: 146 EVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEK 397 ++ +V D T + V+ S PV+V+F A WCGPC+ + P ++E G + K+N D + +A YGI ++PTV FKNGEK Sbjct: 41 DIDSVEDFTEK--VIQSSVPVIVDFHAEWCGPCQALGPRLEEKVNGRQGSVLLAKINVDHAGELAMDYGISAVPTVFAFKNGEK 122
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIO_TREPA (Thioredoxin OS=Treponema pallidum GN=trxA PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 25/72 (34.72%), Postives = 49/72 (68.06%), Query Frame = 2 Query: 188 LDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKD 403 +++ V+V+FWAPWCG C+M+ P+++E+ + + K+N D+ +A + + SIPT+++FK+G++ D Sbjct: 15 IETNPLVIVDFWAPWCGSCKMLGPVLEEVESEVGSGVVIGKLNVDDDQDLAVEFNVASIPTLIVFKDGKEVD 86
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Match: THIOT_DROME (Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 2 Query: 176 QSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNG 391 Q L+L V+++F+A WCGPC++I P +DEL+ +Y ++ KVN DE+ I Y + S+PT + K G Sbjct: 13 QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAHEYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGG 84 The following BLAST results are available for this feature:
BLAST of BQ623527 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 108
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623527 ID=BQ623527; Name=BQ623527; organism=Citrus sinensis; type=EST; length=569bpback to top |