BQ623528
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623528 vs. ExPASy Swiss-Prot
Match: AR8BA_DANRE (ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 2.618e-16 Identity = 37/61 (60.66%), Postives = 50/61 (81.97%), Query Frame = 1 Query: 4 IPLLVLGNKNDLPGAIGVDEIIDKLNLRAVEGREVCVYSISAKNQVNIDMTLEWLIKHSKS 186 IP+LVLGNK DLP A+ ++I+K+NL A++ RE+C YSIS K + NID+TL+WLI+HSKS Sbjct: 123 IPVLVLGNKRDLPNALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIDITLQWLIQHSKS 183
BLAST of BQ623528 vs. ExPASy Swiss-Prot
Match: ARL8_DROME (ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.617e-16 Identity = 36/61 (59.02%), Postives = 50/61 (81.97%), Query Frame = 1 Query: 4 IPLLVLGNKNDLPGAIGVDEIIDKLNLRAVEGREVCVYSISAKNQVNIDMTLEWLIKHSKS 186 IP+LVLGNK DLPGA+ +I+++NL +++ RE+C YSIS K + NID+TL+WLI+HSKS Sbjct: 123 IPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKS 183
BLAST of BQ623528 vs. ExPASy Swiss-Prot
Match: ARL8B_MACFA (ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.299e-15 Identity = 36/61 (59.02%), Postives = 50/61 (81.97%), Query Frame = 1 Query: 4 IPLLVLGNKNDLPGAIGVDEIIDKLNLRAVEGREVCVYSISAKNQVNIDMTLEWLIKHSKS 186 IP+LVLGNK DLP A+ ++I+K+NL A++ RE+C YSIS K + NID+TL+WLI++SKS Sbjct: 123 IPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQYSKS 183 The following BLAST results are available for this feature:
BLAST of BQ623528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623528 ID=BQ623528; Name=BQ623528; organism=Citrus sinensis; type=EST; length=285bpback to top |