CB290810
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB290810 vs. ExPASy Swiss-Prot
Match: IPL1_YEAST (Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae GN=IPL1 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.337e-11 Identity = 35/107 (32.71%), Postives = 58/107 (54.21%), Query Frame = -3 Query: 447 PMRASNSFVGTEEYIAPEIIAGAGHTSAVDWWALGILLYEMLYGYTPFRGKTRQKTFANILHKDLKFPSSTPTSLHAKQLMYRLLHRDPKSRLGSHEGANEIKKHPF 767 P + GT +Y++PE++ + +D WALG+L +E+L G PF + + T+ I D+K PS+ S A+ L+ +LL DPK R+ ++K HP+ Sbjct: 254 PENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSN--ISQDAQDLILKLLKYDPKDRM----RLGDVKMHPW 354
BLAST of CB290810 vs. ExPASy Swiss-Prot
Match: IPL1_ENCCU (Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi GN=IPL1 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.337e-11 Identity = 40/101 (39.60%), Postives = 49/101 (48.51%), Query Frame = -3 Query: 447 SFVGTEEYIAPEIIAGAGHTSAVDWWALGILLYEMLYGYTPFRGKTRQKTFANILHKDLKFPSSTPTSLHAKQLMYRLLHRDPKSRLGSHEGANEIKKHPF 749 +F GT EY+APE++ H S +D W LGIL YE L G TPF K R A LK+ S +A + RLL P R+ E N HPF Sbjct: 166 TFCGTMEYLAPEMVNNDIHDSGIDLWCLGILTYEFLMGKTPFESKNRNMREAYKKINSLKYTIPETISSNASDFISRLLVLSPGDRMELTEALN----HPF 262 The following BLAST results are available for this feature:
BLAST of CB290810 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 342
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB290810 ID=CB290810; Name=CB290810; organism=Citrus sinensis; type=EST; length=817bpback to top |