CB304430
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304430 vs. ExPASy Swiss-Prot
Match: ERH_ECHMU (Enhancer of rudimentary homolog OS=Echinococcus multilocularis GN=ERH PE=3 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 3.066e-14 Identity = 32/84 (38.10%), Postives = 55/84 (65.48%), Query Frame = -3 Query: 376 TRTFMDYGSISQAMDGICGLYERKLKELNPAIRDITYDVADLYNFIDGLADMSALVYDHSIQAYLPYDRQWIKQRTFQHLKKLA 627 +R + DY +++Q ++G+C +YE +LK+ NP ITYD++ L+ FID LAD+S L + + Y+P+ + WIK+ + L+ A Sbjct: 17 SRVWADYETLNQCLEGVCKIYEEQLKQQNPTAPTITYDISQLFKFIDQLADLSCLEFHPATGTYVPHTKDWIKENIYALLRNQA 100
BLAST of CB304430 vs. ExPASy Swiss-Prot
Match: ERH_CAEEL (Enhancer of rudimentary homolog OS=Caenorhabditis elegans GN=T21C9.4 PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 5.782e-13 Identity = 30/78 (38.46%), Postives = 56/78 (71.79%), Query Frame = -3 Query: 394 TRTFMDYGSISQAMDGICGLYERKLKELNPAIRDITYDVADLYNFIDGLADMSALVYDHSIQAYLPYDRQWIKQRTFQ 627 +R++ DY + ++ ++GIC +YE LK+ PA +ITYD++ L+ FID L D+S LV D++ Y+P+++Q++K+ ++ Sbjct: 16 SRSWSDYENTTECLEGICRVYEEYLKKKVPAQNEITYDISHLFEFIDDLKDLSMLVLDNTTYTYVPHNKQYVKESIYK 93 The following BLAST results are available for this feature:
BLAST of CB304430 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304430 ID=CB304430; Name=CB304430; organism=Citrus sinensis; type=EST; length=638bpback to top |