CB304705
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAAS (Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAAR (Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAAN (Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAAM (Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAAC (Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAAB (Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304705 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 212 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 454 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103 The following BLAST results are available for this feature:
BLAST of CB304705 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304705 ID=CB304705; Name=CB304705; organism=Citrus sinensis; type=EST; length=558bpback to top |