CB304749
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_HELPJ (Thioredoxin OS=Helicobacter pylori J99 GN=trxA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.495e-11 Identity = 31/90 (34.44%), Postives = 58/90 (64.44%), Query Frame = -3 Query: 260 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 526 T E++ ++KG+A +VDF A WC PCK++SP++ ELA + KV+ DE + ++ ++ + ++PT + TK+G+V+ ++VG + Sbjct: 8 TEENFESTIKKGVA-----LVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQ 92
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: TRXF_SPIOL (Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 7.260e-11 Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = -3 Query: 233 AAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVD-ELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKGELQLAVE 487 A K +V+D WC PCK M+P +LA++ VIFLK+D + E K++A+E + +PTF + KE V+ + GAK +L A++ Sbjct: 100 AGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQ 185
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: TRXB_MYCLE (Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae GN=trxB/A PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.260e-11 Identity = 31/78 (39.74%), Postives = 55/78 (70.51%), Query Frame = -3 Query: 260 IAAKKLIVVDFTASWCPPCKLMSPILSELA-KKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 490 +++ K ++VDF A+WC PCK+++P+L E+A ++ + K+DVD +A E+ V ++PT +L + G+ ++RIVGAK Sbjct: 364 LSSNKPVLVDFWATWCGPCKMVAPVLEEIASEQRNQLTVAKLDVDTNPEMAREFQVVSIPTMILFQGGQPVKRIVGAK 441
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_MYCSM (Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.260e-11 Identity = 32/80 (40.00%), Postives = 53/80 (66.25%), Query Frame = -3 Query: 260 IAAKKLIVVDFTASWCPPCKLMSPILSELAKKLP---AVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 490 + + K ++VDF A+WC PCK+++P+L E+A + V + VDVD + A ++ V ++PT +L K+G ++RIVGAK Sbjct: 20 LGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAK 99
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_CHLLT (Thioredoxin OS=Chlorobium limicola f.sp. thiosulfatophilum GN=trxA PE=1 SV=5) HSP 1 Score: 67.0106 bits (162), Expect = 7.260e-11 Identity = 30/86 (34.88%), Postives = 56/86 (65.12%), Query Frame = -3 Query: 227 KLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGA-KKGELQLAVEKH 478 K ++VDF ASWC PC ++ P++ +LA I K++VDE ++A ++ + ++PT ++ K GKV++++VGA K + +++H Sbjct: 21 KAVLVDFWASWCGPCMMLGPVIEQLADDYEGKAIIAKLNVDENPNIAGQYGIRSIPTMLIIKGGKVVDQMVGALPKNMIAKKIDEH 106
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_STAES (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.482e-11 Identity = 35/102 (34.31%), Postives = 63/102 (61.76%), Query Frame = -3 Query: 227 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 526 T ++ +++ G+ +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 7 TDSDFDSKIESGVK-----LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_STAEQ (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.482e-11 Identity = 35/102 (34.31%), Postives = 63/102 (61.76%), Query Frame = -3 Query: 227 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 526 T ++ +++ G+ +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 7 TDSDFDSKIESGVK-----LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_STAAW (Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.482e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 227 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 469 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_STAAU (Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.482e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 227 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 469 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB304749 vs. ExPASy Swiss-Prot
Match: THIO_STAAS (Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.482e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 227 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KGELQLAVEKH 469 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103 The following BLAST results are available for this feature:
BLAST of CB304749 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304749 ID=CB304749; Name=CB304749; organism=Citrus sinensis; type=EST; length=567bpback to top |