CB304771
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_THEMA (ATP-dependent Clp protease proteolytic subunit OS=Thermotoga maritima GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 35/75 (46.67%), Postives = 48/75 (64.00%), Query Frame = -3 Query: 459 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 683 IMI QP+G EG A DVEI +E+ +K L ++ +KH G+ E+IE D R + S EA EYGI+DKV+ T + Sbjct: 129 IMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE 203
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_NITEU (ATP-dependent Clp protease proteolytic subunit OS=Nitrosomonas europaea GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 32/79 (40.51%), Postives = 51/79 (64.56%), Query Frame = -3 Query: 447 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPED 683 +MI QP+G +GQA+D+EI KEI +K+ L ++ AKH G+T + IE D R + AV+YG++D VL + + ++ Sbjct: 136 VMIHQPLGGFQGQASDIEIHAKEILALKSRLNEIMAKHTGQTVKAIERDTDRDNFLGAEAAVKYGLVDAVLTSREVKQE 214
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_GEOSM (ATP-dependent Clp protease proteolytic subunit OS=Geobacter sp. (strain M21) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = -3 Query: 471 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 683 IMI QP+G +GQATD+ I KEI +K EL L A+H G++ E++ AD R + S EA YGIID ++ Sbjct: 119 IMIHQPLGGFQGQATDIHIHAKEILRMKDELNALLAEHTGQSVEKVAADTERDYFMSGEEAKNYGIIDAIV 189
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_COLP3 (ATP-dependent Clp protease proteolytic subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = -3 Query: 471 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 683 +MI QP+G +GQA+D EI KEI +K +L KL A+H G+T +++ D R + S AVEYG++D +L Sbjct: 144 VMIHQPLGGFQGQASDFEIHAKEILFIKDKLNKLMAEHTGQTLDKVSQDTDRDNFLSAEAAVEYGLVDSIL 214
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_CHRSD (ATP-dependent Clp protease proteolytic subunit OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 31/71 (43.66%), Postives = 48/71 (67.61%), Query Frame = -3 Query: 471 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 683 +MI QP+G +GQA D+EI KEI N++ +L ++ AKH G+ E + D R + + ++AVEYG+ID +L Sbjct: 130 MMIHQPLGGYQGQAADIEIHTKEILNIRQQLNEILAKHTGQDAETVARDTDRDNFMNGTQAVEYGLIDAML 200
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_BRASB (ATP-dependent Clp protease proteolytic subunit OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 33/79 (41.77%), Postives = 52/79 (65.82%), Query Frame = -3 Query: 447 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPED 683 IM+ QP G +GQATD+ + +EI ++K L ++Y KH G++ + IE + R K+ + A E+G+IDKV+ +K PED Sbjct: 128 IMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQSYKAIEDALERDKFLTAEAAAEFGLIDKVI--DKRPED 204
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP2_PSEAE (ATP-dependent Clp protease proteolytic subunit 2 OS=Pseudomonas aeruginosa GN=clpP2 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11 Identity = 29/74 (39.19%), Postives = 53/74 (71.62%), Query Frame = -3 Query: 459 MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 680 ++ QP G I+G A+++EI R+EI +K L +++A+ G+TPE+I AD R + + EAV+YG+++K++ +E+ Sbjct: 121 LLHQPSGGIQGPASNIEIYRREIVRMKERLDRIFAEATGQTPEKISADTERDFWLNAEEAVQYGLVNKIIVSER 194
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_PSEMY (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas mendocina (strain ymp) GN=clpP PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.024e-11 Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = -3 Query: 453 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSP 683 +MI QP+G +GQA+D+EI KEI ++ L +L A H G++ E IE D R + S AVEYGI+D V + P Sbjct: 136 VMIHQPLGGFQGQASDIEIHAKEILFIRERLNELLAHHTGQSLETIERDTNRDNFMSAPRAVEYGIVDAVHEKRQMP 212
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_FUSNN (ATP-dependent Clp protease proteolytic subunit OS=Fusobacterium nucleatum subsp. nucleatum GN=clpP PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.024e-11 Identity = 36/72 (50.00%), Postives = 45/72 (62.50%), Query Frame = -3 Query: 474 IMIKQPI--GRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 683 IMI QP+ G ++GQATD+ I E+ +K L +L AK+ GKT EQI D R Y S EAV YG+ID V Sbjct: 119 IMIHQPLISGGLKGQATDISIHANELLKIKDRLAELLAKNTGKTKEQILRDTERDNYLSSEEAVNYGLIDSV 190 The following BLAST results are available for this feature:
BLAST of CB304771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 129
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304771 ID=CB304771; Name=CB304771; organism=Citrus sinensis; type=EST; length=685bpback to top |