CB305054
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB305054 vs. ExPASy Swiss-Prot
Match: TIP32_ORYSJ (Probable aquaporin TIP3-2 OS=Oryza sativa subsp. japonica GN=TIP3-2 PE=2 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 8.198e-11 Identity = 37/101 (36.63%), Postives = 56/101 (55.45%), Query Frame = -3 Query: 147 LAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI-YNKDKAWDDQWLFWVGPFIGAAIAASYPQFIL 446 L E++ TF LVYTV++ +RS +APL IG LA P G +NPAR+ G A++ +N W W++W+GP IGA +A + +F++ Sbjct: 152 LLLEVVMTFGLVYTVYATAVDRRSGGGD----IAPLAIGLVAGANILAGGPFDGAAMNPARAFGPALVGWN----WRHHWVYWLGPLIGAGMAGALYEFVM 244
BLAST of CB305054 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.198e-11 Identity = 40/100 (40.00%), Postives = 54/100 (54.00%), Query Frame = -3 Query: 171 GYSTGVGLAAEIIGTFVLVYTVFS-ATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIA 467 G S L EI+ TF LVYTV++ A DPK+ + + +AP+ IGF V L G +NPA S G A++ W QW++WVGP IG +A Sbjct: 137 GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS----LGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALV---SWEWGYQWVYWVGPLIGGGLA 229 The following BLAST results are available for this feature:
BLAST of CB305054 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 122
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB305054 ID=CB305054; Name=CB305054; organism=Citrus sinensis; type=EST; length=478bpback to top |