CB610997
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIO_STAAM (Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 169 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KNDLQLAVEKH 411 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K +L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIO_STAAC (Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 169 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KNDLQLAVEKH 411 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K +L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIO_STAAB (Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 169 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KNDLQLAVEKH 411 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K +L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 169 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KNDLQLAVEKH 411 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K +L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 169 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KNDLQLAVEKH 411 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K +L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIOM_RAT (Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 166 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKND 387 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K D Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDED 155
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIOM_MOUSE (Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 166 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKND 387 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K D Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDED 155
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIOM_HUMAN (Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 166 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKND 387 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K D Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDED 155
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: THIOM_BOVIN (Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 4.509e-11 Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 166 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKND 387 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K D Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKVVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAMKNGDVVDKFVGIKDED 155
BLAST of CB610997 vs. ExPASy Swiss-Prot
Match: TRXF_SPIOL (Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 1 Query: 151 AAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVD-ELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKNDLQLAVE 405 A K +V+D WC PCK M+P +LA++ VIFLK+D + E K++A+E + +PTF + KE V+ + GAK + L A++ Sbjct: 100 AGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQ 185 The following BLAST results are available for this feature:
BLAST of CB610997 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 103
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610997 ID=CB610997; Name=CB610997; organism=Citrus sinensis; type=EST; length=518bpback to top |