CB611080
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB611080 vs. ExPASy Swiss-Prot
Match: DEFA_ANTMA (Floral homeotic protein DEFICIENS OS=Antirrhinum majus GN=DEFA PE=1 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 4.061e-11 Identity = 24/40 (60.00%), Postives = 36/40 (90.00%), Query Frame = 3 Query: 12 QVTFAKRRNGLLKKAYELSVLCDAEVALIIFANRGKLNKF 131 QVT++KRRNGL KKA+ELSVLCDA+V++I+ ++ KL+++ Sbjct: 18 QVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEY 57 HSP 2 Score: 31.9574 bits (71), Expect = 4.061e-11 Identity = 25/98 (25.51%), Postives = 43/98 (43.88%), Query Frame = 1 Query: 235 IQKEYLKLKARYEALQRSQRNLLGEELGPLNS*ELESLERQLDTSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHADFAGLQLMEG 528 +Q+ KL L+R R +GE L L ++ +L +D SLK IR + + + + + + K + + E ++ L R GL EG Sbjct: 87 MQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQIVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLVDNEG 184 The following BLAST results are available for this feature:
BLAST of CB611080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 71
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB611080 ID=CB611080; Name=CB611080; organism=Citrus sinensis; type=EST; length=711bpback to top |