CF417077
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_NATPD (50S ribosomal protein L10e OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=rpl10e PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.840e-16 Identity = 38/122 (31.15%), Postives = 64/122 (52.46%), Query Frame = 3 Query: 48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDA-FHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410 M +PA YR I Y + + G+P K+ Y +G + +++ + L+ E+ + +LEA+R++ N+ M K G+D + + +R P V+R NK + AGADR+ GM F K Sbjct: 1 MSDKPASMYRDIDKPAYTRREYITGIPGSKVAQYKMGNFEADPEDYEVQISLIVDEEVQIRHGSLEASRLSANRRMLKELGEDGDYKMILRKFPHQVIRENKQATGAGADRVSDGMRQAFGK 122 HSP 2 Score: 33.8834 bits (76), Expect = 6.840e-16 Identity = 20/54 (37.04%), Postives = 29/54 (53.70%), Query Frame = 1 Query: 394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSR 555 R AFGK GT AR+ G+ + ++ C ++ A++A RRA K I V R Sbjct: 117 RQAFGKIVGTAARINKGERVFTIWCHPEDADAAKDAFRRAYNKISPPCTIKVER 170 The following BLAST results are available for this feature:
BLAST of CF417077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 91
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF417077 ID=CF417077; Name=CF417077; organism=Citrus sinensis; type=EST; length=703bpback to top |