CF503857
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBA1_CHICK (Tubulin alpha-1 chain (Fragment) OS=Gallus gallus PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.940e-12 Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 3 Query: 144 ERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326 + N +++E G++VPRAV +DLEP +D +R+G Y Q+F P+ + G+ A NN+A+GH Sbjct: 8 DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 68
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: YI016_HUMAN (Putative tubulin beta chain-like protein ENSP00000290377 OS=Homo sapiens PE=5 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 5.795e-11 Identity = 26/32 (81.25%), Postives = 30/32 (93.75%), Query Frame = 3 Query: 228 MDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKG 323 MDS+RSGP+GQ+ RPDNF+FGQ GAGNNWAKG Sbjct: 1 MDSVRSGPFGQVLRPDNFIFGQCGAGNNWAKG 32 The following BLAST results are available for this feature:
BLAST of CF503857 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 402
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF503857 ID=CF503857; Name=CF503857; organism=Citrus sinensis; type=EST; length=328bpback to top |