CF504117
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF504117 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1) HSP 1 Score: 119.783 bits (299), Expect = 5.289e-27 Identity = 54/66 (81.82%), Postives = 61/66 (92.42%), Query Frame = 3 Query: 252 LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADY 449 LKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY Sbjct: 1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDY 66
BLAST of CF504117 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 2.085e-15 Identity = 37/38 (97.37%), Postives = 37/38 (97.37%), Query Frame = 3 Query: 336 LGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADY 449 LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADY Sbjct: 1 LGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADY 38 The following BLAST results are available for this feature:
BLAST of CF504117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 142
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504117 ID=CF504117; Name=CF504117; organism=Citrus sinensis; type=EST; length=450bpback to top |